Protein Info for Pf6N2E2_3194 in Pseudomonas fluorescens FW300-N2E2
Annotation: probable exported protein YPO1624
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 57% identical to YCFJ_ECOL6: Uncharacterized protein YcfJ (ycfJ) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
KEGG orthology group: None (inferred from 100% identity to pba:PSEBR_a920)Predicted SEED Role
"probable exported protein YPO1624"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A160A140 at UniProt or InterPro
Protein Sequence (182 amino acids)
>Pf6N2E2_3194 probable exported protein YPO1624 (Pseudomonas fluorescens FW300-N2E2) VNKSMLVGAVLGAVGVTAGGAVATYSLVKSGPEYAQVLAVEPVKTQIKTPREVCKDVTVT RQKPVQDQHQIAGTVLGAVAGGLLGNQIGGGTGKKIATVAGAAGGGYAGNKIQEGMQERD TYTTTQTRCNTVNDISDKVVGYDVRYMLDGKEGKVRMDRDPGNQIPVNKEGQLILGQNEP AQ