Protein Info for Pf6N2E2_3174 in Pseudomonas fluorescens FW300-N2E2

Annotation: GTP-binding protein EngA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 TIGR03594: ribosome-associated GTPase EngA" amino acids 3 to 451 (449 residues), 576.6 bits, see alignment E=5.3e-177 TIGR00231: small GTP-binding protein domain" amino acids 4 to 157 (154 residues), 75 bits, see alignment E=8.6e-25 amino acids 195 to 357 (163 residues), 80.7 bits, see alignment E=1.6e-26 PF02421: FeoB_N" amino acids 5 to 130 (126 residues), 57.6 bits, see alignment E=5.5e-19 amino acids 196 to 356 (161 residues), 49.7 bits, see alignment E=1.5e-16 PF01926: MMR_HSR1" amino acids 5 to 119 (115 residues), 106 bits, see alignment E=6.1e-34 amino acids 197 to 315 (119 residues), 96.8 bits, see alignment E=4.6e-31 PF00009: GTP_EFTU" amino acids 196 to 364 (169 residues), 39.3 bits, see alignment E=2.6e-13 PF14714: KH_dom-like" amino acids 371 to 451 (81 residues), 93.3 bits, see alignment E=4.7e-30

Best Hits

Swiss-Prot: 96% identical to DER_PSEF5: GTPase Der (der) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K03977, GTP-binding protein (inferred from 100% identity to pba:PSEBR_a940)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A125 at UniProt or InterPro

Protein Sequence (490 amino acids)

>Pf6N2E2_3174 GTP-binding protein EngA (Pseudomonas fluorescens FW300-N2E2)
MVPVIALVGRPNVGKSTLFNRLTRTRDAIVGDLSGLTRDRQYGEAKWQGRTYILVDTGGI
SGDEHGMDEKMAEQSLLAIEEADVVLFLVDAKAGFTAADQMIAEHLRKRNKRSYVVANKV
DNIDPDMARAEFAPLGMGQAIPIAGAHGRGITQMLEIALESFPKDDVEEPEEGEEEIVAE
GEEAKRIPGPSEKDGIKIAIIGRPNVGKSTLVNRMLGEDRVIVYDQPGTTRDSIYIPFER
NEEKYTLIDTAGVRKRGKIHEEVEKFSVVKTLQAIKDANVVIFVMDAREGVVDHDLNLLG
FALEAGRALVIAINKWDGMTPSERDFVKVELQRRLFFVDFADIHFISALHGTGVGNLYAS
VQNSFKSAVTRWPTNRLTQILEDAVGEHAPPMVNNRRIKLRYAHLGGANPPIIVIHGNQI
EKVPKSYVRYLENTYRRVLKLVGTPIRIEFKGGENPYEGNKNTLTDRQVNKKRRLMSHHK
KADKKRRDKR