Protein Info for Pf6N2E2_3145 in Pseudomonas fluorescens FW300-N2E2

Annotation: Tyrosine recombinase XerD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF13495: Phage_int_SAM_4" amino acids 8 to 92 (85 residues), 27.2 bits, see alignment E=6.1e-10 PF02899: Phage_int_SAM_1" amino acids 9 to 91 (83 residues), 70.6 bits, see alignment E=1.7e-23 TIGR02225: tyrosine recombinase XerD" amino acids 10 to 297 (288 residues), 389.7 bits, see alignment E=4.1e-121 PF00589: Phage_integrase" amino acids 113 to 284 (172 residues), 185.7 bits, see alignment E=9.4e-59

Best Hits

Swiss-Prot: 88% identical to XERD_PSEPK: Tyrosine recombinase XerD (xerD) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K04763, integrase/recombinase XerD (inferred from 100% identity to pba:PSEBR_a994)

Predicted SEED Role

"Tyrosine recombinase XerD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZDK9 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Pf6N2E2_3145 Tyrosine recombinase XerD (Pseudomonas fluorescens FW300-N2E2)
MPAIDHPLIDQFLDALWLEKGLSDNTRDAYRSDLALFNGWLQENHLELINAGRELILDHL
AWRLEQNYKPRSTARFLSGLRGFYRYLLREKLIAVDPTLRVEMPQLGRPLPKSLSEADVE
ALLAAPDLSEAIGQRDRAMLEVLYACGLRVTELISLTLEQVNLRQGVLRVMGKGSKERLV
PMGEEAIVWVERYMRDARHELLGGRPSDVLFPSLRGEQMTRQTFWHRIKHQAKVAGINKS
LSPHTLRHAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARARLQDLHAKHHPRG