Protein Info for Pf6N2E2_3141 in Pseudomonas fluorescens FW300-N2E2

Annotation: virulence sensor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 291 to 310 (20 residues), see Phobius details PF00497: SBP_bac_3" amino acids 63 to 273 (211 residues), 72.5 bits, see alignment E=7.7e-24 PF00989: PAS" amino acids 335 to 443 (109 residues), 28.2 bits, see alignment E=3.3e-10 PF08448: PAS_4" amino acids 339 to 449 (111 residues), 41.1 bits, see alignment E=3.6e-14

Best Hits

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a998)

Predicted SEED Role

"virulence sensor protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZDD5 at UniProt or InterPro

Protein Sequence (456 amino acids)

>Pf6N2E2_3141 virulence sensor protein (Pseudomonas fluorescens FW300-N2E2)
MSFFSKCKPARGWVMGLALMHWVQGGNATQLAAFETPPFNPGERLVLDAQELKWIKENPR
VIVATMQFPLYLFKNELGQWNGLNHDILQRISQMTGLEFVHRESFSPGELLTMLENSEAD
MTTLLAMNDERRDFLSFSHAFGGSGWVFVGRDGESILHSLEQLEGKVLALPARHALEAEI
RRDYPAIKLRTTKTYGEARALVESREAYATIENETGVHLYPAGQLQVGRGLEGKWEPDYL
AVRQDLAVLLSILNKALEAFPAKDMRALRSKWMAGSTPAPAPSIWERFSRWGYWCVTVVV
VFGLLSLLWNRRLQIQIDQRLKAEAVLKDQLMLQRALMDAIPDPIFIRDLEGRLVMCNKS
YEDQLATRFEKLRGTRLTDSAAFPPATAELLHGEVMEQLRTGQSRFFDRQLMFSSGLREI
YHWSVPFYGADGQLRGILGGWTDAGRRRRRCDKLMA