Protein Info for Pf6N2E2_3137 in Pseudomonas fluorescens FW300-N2E2

Annotation: Single-stranded-DNA-specific exonuclease RecJ (EC 3.1.-.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 transmembrane" amino acids 182 to 200 (19 residues), see Phobius details TIGR00644: single-stranded-DNA-specific exonuclease RecJ" amino acids 20 to 565 (546 residues), 502.5 bits, see alignment E=6.1e-155 PF01368: DHH" amino acids 69 to 226 (158 residues), 95.7 bits, see alignment E=4.1e-31 PF02272: DHHA1" amino acids 354 to 445 (92 residues), 59.6 bits, see alignment E=5.3e-20 PF17768: RecJ_OB" amino acids 461 to 564 (104 residues), 80.5 bits, see alignment E=1.4e-26

Best Hits

Swiss-Prot: 58% identical to RECJ_SALTY: Single-stranded-DNA-specific exonuclease RecJ (recJ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07462, single-stranded-DNA-specific exonuclease [EC: 3.1.-.-] (inferred from 100% identity to pba:PSEBR_a1002)

MetaCyc: 57% identical to ssDNA-specific exonuclease RecJ (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease VII. [EC: 3.1.11.6]

Predicted SEED Role

"Single-stranded-DNA-specific exonuclease RecJ (EC 3.1.-.-)" in subsystem DNA-replication or DNA Repair Base Excision or DNA repair, bacterial RecFOR pathway (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-, 3.1.11.6

Use Curated BLAST to search for 3.1.-.- or 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZ30 at UniProt or InterPro

Protein Sequence (569 amino acids)

>Pf6N2E2_3137 Single-stranded-DNA-specific exonuclease RecJ (EC 3.1.-.-) (Pseudomonas fluorescens FW300-N2E2)
MRIEPRQLPDTLPFLGDLPPLLTRLYAARGVQSEAELDKSLARLIPFQQLKGIDAAVDLL
VTALEQRQRILIVGDFDADGATASTVGMLGLRLLGAAHVDYLVPNRFEYGYGLTPEIVEV
ALAREPQLLITVDNGISSVEGVAAAKAAGLQVLVTDHHLPGLELPAADAIVNPNQPGCEF
PSKALAGVGVIFYVLMALRARLRSLGWYASTPQPNIGELLDLVALGSVADVVPLDANNRI
LVHQGLERIRAGRARPGIKAILEVAKRDASRITSTDLGFILGPRLNAAGRLDDMSLGIEC
LLTDDPALAREMAAQLDGMNQDRKSIEQGMQREALAQLKDLPVESMPFGLCLFDPQWHQG
VIGILASRMKERYFRPTIAFADAGDGLLKGSGRSVPGFHIRDALSVVAAQHPTLISKYGG
HAMAAGLTLPEANFPLFAEAFDAEVRRQLREEDLTGRLLSDGTLAVEEFHLELARALRHA
GPWGQHFPEPMFHGVFQLVEQRVVGERHLKVILKSECGSVKLDGIAFGIDREIWPNPTVR
WVELAYKLDLNEFRGQETVQLMIAHIEPR