Protein Info for Pf6N2E2_312 in Pseudomonas fluorescens FW300-N2E2

Annotation: Histone acetyltransferase HPA2 and related acetyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 PF00583: Acetyltransf_1" amino acids 38 to 117 (80 residues), 49.8 bits, see alignment E=6e-17 PF13508: Acetyltransf_7" amino acids 41 to 119 (79 residues), 47.2 bits, see alignment E=3.7e-16 PF13673: Acetyltransf_10" amino acids 44 to 122 (79 residues), 30.1 bits, see alignment E=6.2e-11

Best Hits

KEGG orthology group: None (inferred from 92% identity to pba:PSEBR_a3548)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YRN6 at UniProt or InterPro

Protein Sequence (143 amino acids)

>Pf6N2E2_312 Histone acetyltransferase HPA2 and related acetyltransferases (Pseudomonas fluorescens FW300-N2E2)
MTLRIERTDAPTDEERQAILAPLRAYNTAKTGGTVPELVAWLVRDEHDEIVGGLYGRVFF
RWLYIELLVVPEQARGQGTGSTLMQMAEALAREKNCVGIWLDTFDFQAPEFYRRHGFTEI
GQIDDYPPGHQHFFFQKRLTPSD