Protein Info for Pf6N2E2_31 in Pseudomonas fluorescens FW300-N2E2

Annotation: Iron(III) dicitrate transport protein FecA @ Iron siderophore receptor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 812 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF07660: STN" amino acids 60 to 109 (50 residues), 49.5 bits, see alignment 4.2e-17 PF07715: Plug" amino acids 142 to 255 (114 residues), 77 bits, see alignment E=2.3e-25 TIGR01783: TonB-dependent siderophore receptor" amino acids 143 to 812 (670 residues), 293.4 bits, see alignment E=2.1e-91 PF00593: TonB_dep_Rec" amino acids 338 to 780 (443 residues), 184.6 bits, see alignment E=9.8e-58

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 87% identity to pfl:PFL_4039)

Predicted SEED Role

"Iron(III) dicitrate transport protein FecA @ Iron siderophore receptor protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YH71 at UniProt or InterPro

Protein Sequence (812 amino acids)

>Pf6N2E2_31 Iron(III) dicitrate transport protein FecA @ Iron siderophore receptor protein (Pseudomonas fluorescens FW300-N2E2)
VKTTAKNNNRTHVRWLPLALTLAVSAAVPQAYADQATTAIHIQAQPLGQALSQLGQQTAL
QVFFSPELVAGKQAPAVDGTLSPEAALHQLLQGSGLQYQIDEGSATVLPAPSASSAGPLE
LGATEIQVVGDWLGDANAEVVQNHPGARTVIRREAMVEQGAMNVGDVLRRVPGVQVQDAN
GTGGSDISLNVGVRGLTSRLSPRSTVLIDGVPAAFAPYGQPQLSMAPISSGNLDSIDVVR
GAGSVRYGPQNVGGVINFVTRAIPEKATGEIGSTLETSQRGGWKHIDTAFLGGTADNGLG
VALLYSGVNGNGYRRSNNDNDIDDVILKTHWAPTEVDDFSLNFHYYDAKADMPGGLTQAQ
YDADPYQSDRDWDNFSGRRKDVSFKWLRQIDDRTQAEVLTYYSDSYRGSTIASRDQRNLV
SYPRTYYTFGIEPRVSHVFDLGPTTQEASVGYRYLKEGMHEEASRLALRDNEPVVRPGAD
GHVYQDRTGGTEAHAVYIDDKIDVGKWTITPGIRFESISTEWHDRPVLDTAGRPVQEKRR
SIDSNEPLPALSVMYHLSDAWKLFANYETSFGSLQYFQLGQGGDGNNTANGLSPEKAKTY
EIGTRYNDDVWGGEVTLFYIDFDDELQYISNDVGWTNMGATKHQGLEASVHYDMAALDPR
LEGLTANAGFTYTRATYEGEIPSFKGRDLPFYSRQVANLGLRYDVNRWTYNLDAFAQSKQ
RSPGNSVNADGSFSGDYITDGSADGQYGDMPGYVLWNVRAGYDFGAQLSNLKVGAGVKNL
FDHQYYTRSSDNNSGMYVGAPRTFFVQASVGF