Protein Info for Pf6N2E2_3089 in Pseudomonas fluorescens FW300-N2E2

Annotation: Lipoprotein-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF09619: YscW" amino acids 33 to 127 (95 residues), 121.7 bits, see alignment E=8.7e-40

Best Hits

KEGG orthology group: K09914, putative lipoprotein (inferred from 93% identity to pba:PSEBR_a1046)

Predicted SEED Role

"Lipoprotein-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZD18 at UniProt or InterPro

Protein Sequence (140 amino acids)

>Pf6N2E2_3089 Lipoprotein-related protein (Pseudomonas fluorescens FW300-N2E2)
MSQVHPMKKLALLASMALLAACQSATPPSTTVAALDGEVFYLQRIALPPNATLSVSLQDV
SLADAPAVVLDEQSGPIKGQVPLPFHLSYDPTQVKPGHRYAVSARIEVDGQLMFITTEQH
TVQLDGKDPQPLKIRVNAAR