Protein Info for Pf6N2E2_3081 in Pseudomonas fluorescens FW300-N2E2

Annotation: HesA/MoeB/ThiF family protein related to EC-YgdL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 PF00899: ThiF" amino acids 15 to 255 (241 residues), 145.2 bits, see alignment E=9.5e-47

Best Hits

Swiss-Prot: 56% identical to TCDA_ECOLI: tRNA threonylcarbamoyladenosine dehydratase (tcdA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to pba:PSEBR_a1053)

MetaCyc: 56% identical to tRNA threonylcarbamoyladenosine dehydratase (Escherichia coli K-12 substr. MG1655)
RXN0-7115

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWX6 at UniProt or InterPro

Protein Sequence (272 amino acids)

>Pf6N2E2_3081 HesA/MoeB/ThiF family protein related to EC-YgdL (Pseudomonas fluorescens FW300-N2E2)
MVMSTEDPRFAGIARLYGIEGLARLRAAHVAIVGVGGVGSWAAEAIARCGVGEISLFDLD
DVCVSNANRQLHALDSTVGKPKVEVMAERLRGINPDCTVHAVADFVTRDTMAEYITPNID
CVIDCIDSVNAKAALIAWCKRRKIQIITTGGAGGQIDPTLIQVCDLNRTFNDPLASKVRS
TLRRDYGFSRTVTRHYSVPCVFSTEQLRYPKPDGSICLQKSFVGDGVKLDCAGGFGAVMM
VTATFGMVAATKAVDKIVAGVRRPADRVKPGQ