Protein Info for Pf6N2E2_3065 in Pseudomonas fluorescens FW300-N2E2

Annotation: Undecaprenyl diphosphate synthase (EC 2.5.1.31)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 TIGR00055: di-trans,poly-cis-decaprenylcistransferase" amino acids 12 to 239 (228 residues), 300.4 bits, see alignment E=3.6e-94 PF01255: Prenyltransf" amino acids 19 to 239 (221 residues), 272.5 bits, see alignment E=1.2e-85

Best Hits

Swiss-Prot: 90% identical to UPPS_PSEPK: Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) (uppS) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00806, undecaprenyl diphosphate synthase [EC: 2.5.1.31] (inferred from 98% identity to pba:PSEBR_a1069)

MetaCyc: 58% identical to ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific] (Escherichia coli K-12 substr. MG1655)
Di-trans,poly-cis-decaprenylcistransferase. [EC: 2.5.1.31]

Predicted SEED Role

"Undecaprenyl diphosphate synthase (EC 2.5.1.31)" (EC 2.5.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZQ2 at UniProt or InterPro

Protein Sequence (251 amino acids)

>Pf6N2E2_3065 Undecaprenyl diphosphate synthase (EC 2.5.1.31) (Pseudomonas fluorescens FW300-N2E2)
MEKTKQAVPFAVPRHVAIIMDGNNRWAKKRFMPGVAGHKAGVDAVRAVIEVCAEAGVEVL
TLFAFSSENWQRPADEVSALMDLFLKALRREAKRLNDNKISLRIIGDRSRFHPELQAAMR
EAEAATAGADRFVLQIAANYGGQWDIAQAAQRLAREVQAGHLRPEDITPELLQTCLATGD
LPLPDLCIRTGGEHRISNFLLWQLAYAELYFSDLFWPDFKHDAMRTALADFASRQRRFGK
TSEQIEAGARV