Protein Info for Pf6N2E2_3062 in Pseudomonas fluorescens FW300-N2E2

Annotation: Membrane-associated zinc metalloprotease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 92 to 115 (24 residues), see Phobius details amino acids 377 to 406 (30 residues), see Phobius details amino acids 418 to 439 (22 residues), see Phobius details TIGR00054: RIP metalloprotease RseP" amino acids 2 to 445 (444 residues), 388.3 bits, see alignment E=2.1e-120 PF02163: Peptidase_M50" amino acids 5 to 431 (427 residues), 251.6 bits, see alignment E=1.4e-78 PF17820: PDZ_6" amino acids 124 to 153 (30 residues), 27.4 bits, see alignment (E = 5.5e-10) amino acids 223 to 273 (51 residues), 40.5 bits, see alignment 4.6e-14 PF00595: PDZ" amino acids 216 to 254 (39 residues), 26.6 bits, see alignment 1.6e-09 PF13180: PDZ_2" amino acids 221 to 283 (63 residues), 32.2 bits, see alignment E=2.6e-11

Best Hits

Swiss-Prot: 78% identical to Y3649_PSEAE: Putative zinc metalloprotease PA3649 (PA3649) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K11749, regulator of sigma E protease [EC: 3.4.24.-] (inferred from 99% identity to pba:PSEBR_a1072)

Predicted SEED Role

"Membrane-associated zinc metalloprotease" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0U5 at UniProt or InterPro

Protein Sequence (445 amino acids)

>Pf6N2E2_3062 Membrane-associated zinc metalloprotease (Pseudomonas fluorescens FW300-N2E2)
MIVGTLVALGVLVTFHEFGHFWVARRCGVKVLRFSVGFGMPLLRWHDKKGTEFVVAAIPL
GGYVKMLDEREGEVPADQLDQSFNRKTVRQRIAIVAAGPIANFLLAMVFFWGLAMLGSEQ
VRPVIGAVESGSVAARAGLGVGQEIVAIDGEPTSGWAAVNLQLVRRLGESGSLQLMVREQ
GSTVDSPRELILDNWLKGADEPDPIRSLGIRPWRPAMPPILAELDPKGPAQAAGLKTGDR
LLALDGQPVSDWQQVVDSVRVRPDTKIVLRIERDGAPIDVPVTLAARGESKAPSGYLGAG
VKAVDWPPEMIREVSFGPVAAIGEGARRTWTMSVLTLDSLKKMLFGELSVKNLSGPITIA
KVAGASAQSGVADFLNFLAYLSISLGVLNLLPIPVLDGGHLLFYLIEWARGRPLSDRVQG
WGIQIGISLVVGVMLLALVNDLGRL