Protein Info for Pf6N2E2_3052 in Pseudomonas fluorescens FW300-N2E2

Annotation: tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 PF01171: ATP_bind_3" amino acids 25 to 200 (176 residues), 191 bits, see alignment E=2.6e-60 TIGR02432: tRNA(Ile)-lysidine synthetase" amino acids 26 to 204 (179 residues), 167.6 bits, see alignment E=3e-53 PF09179: TilS" amino acids 256 to 321 (66 residues), 51.6 bits, see alignment E=1.4e-17 PF11734: TilS_C" amino acids 363 to 421 (59 residues), 60.9 bits, see alignment E=9e-21 TIGR02433: tRNA(Ile)-lysidine synthetase, C-terminal domain" amino acids 363 to 408 (46 residues), 56.1 bits, see alignment 2e-19

Best Hits

Swiss-Prot: 69% identical to TILS_PSEPF: tRNA(Ile)-lysidine synthase (tilS) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K04075, tRNA(Ile)-lysidine synthase [EC: 6.3.4.-] (inferred from 94% identity to pba:PSEBR_a1082)

Predicted SEED Role

"tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)" (EC 6.3.4.19)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.- or 6.3.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0T7 at UniProt or InterPro

Protein Sequence (441 amino acids)

>Pf6N2E2_3052 tRNA(Ile)-lysidine synthetase (EC 6.3.4.19) (Pseudomonas fluorescens FW300-N2E2)
MNHSTDLPTRLLTQLSPWRNAANWRIAFSGGLDSTVLLHLLVTLSQRQPLPPLSALHVHH
GLQAVAEAWPDHCRSVCAALGVPLDVVAVQVRPGPSVERAAREARYAAFVAAIHRNEVLL
TAQHRDDQAETLLFRLLRGAGVKGLAAMPAQRPLGQGHLLRPLLDVPRAELEAYARQHGL
SWIEDPSNDDHRYARNYLRQRVFPVLAKQWPQASTTLARSAAHMGEAQGLLDDLAQIDLA
QAATPGAFDWLGLQSLALAPLRALSPARQRNALSHWLAPMTLLPDTDHWSGWDSLRDAAD
DARPIWRLAGGELHRAAGRVWWLSDHWLCSLPGTVDWADPAVALRLPGNGRVVLDGTPPA
GPLSVRYRQGGEVMVLAGRGHRDLKRLLNEKAVPVFVRGRLPLLYQGEQLLAVANLTGLD
AQADGSWQLIWTPGSQDLGLS