Protein Info for Pf6N2E2_3007 in Pseudomonas fluorescens FW300-N2E2

Annotation: Phage tail length tape-measure protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 524 transmembrane" amino acids 181 to 209 (29 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 240 to 265 (26 residues), see Phobius details amino acids 269 to 295 (27 residues), see Phobius details amino acids 312 to 332 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 94% identity to pba:PSEBR_a1108)

Predicted SEED Role

"Phage tail length tape-measure protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZK9 at UniProt or InterPro

Protein Sequence (524 amino acids)

>Pf6N2E2_3007 Phage tail length tape-measure protein (Pseudomonas fluorescens FW300-N2E2)
MADTQTVEKKAVLLTGIDELSPKLAGLRTKVASFKQNLDATGLGSLDISGLLPSGGLAQP
FMDGLKSALAFKDEVGAASAAASAVQTPDAPRVAAQNLEGLKTSISNVSVQFGSALGPAV
NAVAVSLQPMVNGVAQVLQDNPQLVQGLANGVVAFNAIQMAVSGASQAFEVVNQALKMNP
IGLIAMGIALAAGMIIAHWTPISAFFAGLWQRLAPIVLPMVEFFKTMFAFTPMGQVISNW
APISSFFGALWNVVVAAATPVIGFMQTLFAWSPLGLIIANWAPLTGLFAAIWDLLKALTV
PVMDALKGLFDWTPLGLIMANWGTIGEVFAGICEGVRNQVAIMLAVFSGLFDWSPIEGLT
QQWGPVGEWFSQWWNELQAVIAPIKAFFSGGFGEMITSFTAKVEGLTEAQRATNVEGKGE
LAPAFFGAANEQPPGLSSSLAPASANVLAKTSLAPGTLPQTSSALVQQSAANNRTQLEGG
LTVRFENAPAGLRADPPQTNQPALAVSSRIGYRSLSTGGSNELA