Protein Info for Pf6N2E2_2985 in Pseudomonas fluorescens FW300-N2E2

Annotation: Diacylglycerol kinase (EC 2.7.1.107)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 59 to 82 (24 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details PF01219: DAGK_prokar" amino acids 18 to 119 (102 residues), 112.1 bits, see alignment E=5.1e-37

Best Hits

Swiss-Prot: 79% identical to KDGL_PSEAE: Diacylglycerol kinase (dgkA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00901, diacylglycerol kinase [EC: 2.7.1.107] (inferred from 99% identity to pba:PSEBR_a1129)

MetaCyc: 47% identical to diacylglycerol kinase (Escherichia coli K-12 substr. MG1655)
Diacylglycerol kinase. [EC: 2.7.1.107]

Predicted SEED Role

"Diacylglycerol kinase (EC 2.7.1.107)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.1.107)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.107

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZJ3 at UniProt or InterPro

Protein Sequence (120 amino acids)

>Pf6N2E2_2985 Diacylglycerol kinase (EC 2.7.1.107) (Pseudomonas fluorescens FW300-N2E2)
MSPFKGQTGLKRILNASGYSLDGLRAAFVGEAAFRQLVLLNVVLIPLSFFLNVSRVEQAL
LIAVCLLALIVELLNSAVEAAIDRISLELHPLSKNAKDMGSAAQLVALTMIALVWGVVLL