Protein Info for Pf6N2E2_2977 in Pseudomonas fluorescens FW300-N2E2

Annotation: Kup system potassium uptake protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 633 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 217 to 242 (26 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 296 to 321 (26 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details amino acids 376 to 400 (25 residues), see Phobius details amino acids 406 to 424 (19 residues), see Phobius details amino acids 430 to 451 (22 residues), see Phobius details PF02705: K_trans" amino acids 22 to 473 (452 residues), 615.6 bits, see alignment E=4.5e-189 PF22776: K_trans_C" amino acids 486 to 633 (148 residues), 176.4 bits, see alignment E=3.5e-56

Best Hits

Swiss-Prot: 94% identical to KUP_PSEPF: Probable potassium transport system protein kup (kup) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03549, KUP system potassium uptake protein (inferred from 97% identity to pba:PSEBR_a1137)

MetaCyc: 53% identical to K+:H+ symporter Kup (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-3

Predicted SEED Role

"Kup system potassium uptake protein" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZCB3 at UniProt or InterPro

Protein Sequence (633 amino acids)

>Pf6N2E2_2977 Kup system potassium uptake protein (Pseudomonas fluorescens FW300-N2E2)
MGHASSQAASAEHSAAKPLSMLVAAVGVVYGDIGTSPLYTLKEVFSGAYGVPVNHDGVLG
ILSLIFWSLIWVVSIKYMMFVLRADNQGEGGIMALTALARRAAAGRARLRKLLVVCGLIG
AALFYGDSMITPAISVLSAIEGLGLAFEGIDHWVVPLSLVVLVGLFLIQRHGTARIGTLF
GPIMVTWFLVLGALGVYGIAQHPEVLQAVNPVWAVRFFIVHPGMGVAILGAVVLALTGAE
ALYADMGHFGRKPIARAWFILVLPALVLNYFGQGALLLGDPEAARNPFYLLAPSWALLPL
VGLSTLATVIASQAVISGAFSLTRQAIQLGYIPRMYIQHTSSAEQGQIYIGAVNWSLMVG
VVLLVLGFESSGALASAYGVAVTGTMLMTTILVSAVILLLWKWPPLLAVPLLLGFLLVDG
LYFAANVPKIIQGGAFPVIAGIVLFVLMTTWKRGKQLLVERLDEGALPLPIFISSIRVQP
PHRVQGTAVFLTARSDAVPHALLHNLLHNQVLHEQVVLLTVVYEDIPRVPPQRRFEVDAY
GEGFFRVILHFGFTDEPDVPLALKLCHLDDLDFSPMRTTYFLSRETVIASKLEGMARWRE
ILFAFMLKNANGNLRFFNLPLNRVIELGTQVEM