Protein Info for Pf6N2E2_297 in Pseudomonas fluorescens FW300-N2E2

Annotation: Cell division protein FtsK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 801 transmembrane" amino acids 26 to 45 (20 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details PF13491: FtsK_4TM" amino acids 22 to 193 (172 residues), 135.1 bits, see alignment E=4e-43 PF17854: FtsK_alpha" amino acids 307 to 407 (101 residues), 113.4 bits, see alignment E=1e-36 PF01580: FtsK_SpoIIIE" amino acids 417 to 627 (211 residues), 249.2 bits, see alignment E=6.7e-78 PF09397: FtsK_gamma" amino acids 735 to 795 (61 residues), 88.9 bits, see alignment 2.9e-29

Best Hits

Swiss-Prot: 89% identical to FTSK_PSEU2: DNA translocase FtsK (ftsK) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03466, DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family (inferred from 100% identity to pba:PSEBR_a3563)

Predicted SEED Role

"Cell division protein FtsK" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton or Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YR27 at UniProt or InterPro

Protein Sequence (801 amino acids)

>Pf6N2E2_297 Cell division protein FtsK (Pseudomonas fluorescens FW300-N2E2)
LKKSTAAPKPVVPLWRQQLHYRLKEGALIAIGALCLFLMMALLTYGKDDPGWSHNSKIDD
VQNFGGPAGSYSADILFMVLGYFAYIFPLLLAIKAYQIFRQRHEPWQWSGWLFSWRLIGL
VFLVLSGAALAHIHFHAPTGLPAGAGGALGESLGDLARNALNIQGSTLLFIALFLFGLTV
FTDLSWFKVMDVTGKITLDLIELIQGAMNRWWAARTERKQLVAQLREVDDRVHDVVAPTT
PDKREQAKVKERLIEREQALSKHMSEREKQVPPVITMAPAKPPEQSKRVQKEKQAPLFVD
SAVEGTLPPISILDPAEKKQLNYSPESLAAVGHLLEIKLKEFGVEVSVDSIHPGPVITRY
EIQPAAGVKVSRIANLAKDLARSLAVTSVRVVEVIPGKTTVGIEIPNEDRQIVRFSEVLS
TPEYDNHKSPVTLALGHDIGGKPVITDLAKMPHLLVAGTTGSGKSVGVNAMILSILFKSG
PEDAKLIMIDPKMLELSIYEGIPHLLCPVVTDMKDAANALRWSVAEMERRYKLMAKMGVR
NLSGFNAKVKEAEEAGTPLSDPLYHRENIHDEAPLLHKLPTIVVVVDEFADMMMIVGKKV
EELIARIAQKARAAGIHLILATQRPSVDVITGLIKANIPTRMAFQVSSKIDSRTIIDQGG
AEQLLGHGDMLYMPPGTSLPIRVHGAFVSDDEVHRVVEAWKLRGAPEYNDDILNGVEEAG
SGFEGSSGGGDDDAETDALYDEAVQFVLESRRASISAVQRKLKIGYNRAARMIEAMEMAG
VVTAMNTNGSREVLAPGPMRD