Protein Info for Pf6N2E2_2963 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG003033: Helicase domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 828 TIGR04121: DEXH box helicase, DNA ligase-associated" amino acids 8 to 820 (813 residues), 1131.7 bits, see alignment E=0 PF00270: DEAD" amino acids 22 to 201 (180 residues), 86.1 bits, see alignment E=4.9e-28 PF00271: Helicase_C" amino acids 250 to 357 (108 residues), 47.9 bits, see alignment E=3e-16 PF19306: Lhr_WH" amino acids 399 to 547 (149 residues), 188.9 bits, see alignment E=9.2e-60 PF08494: DEAD_assoc" amino acids 605 to 790 (186 residues), 174 bits, see alignment E=6.6e-55

Best Hits

KEGG orthology group: K03724, ATP-dependent helicase Lhr and Lhr-like helicase [EC: 3.6.4.-] (inferred from 97% identity to pba:PSEBR_a1150)

Predicted SEED Role

"FIG003033: Helicase domain protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZY99 at UniProt or InterPro

Protein Sequence (828 amino acids)

>Pf6N2E2_2963 FIG003033: Helicase domain protein (Pseudomonas fluorescens FW300-N2E2)
MATSNNFAKQWFDARGWKPFVFQKQVWAAVKRGESGLLHASTGAGKTYAVWLAALNRFAR
PAPPLDKPRKRKPPAEPLTVLWITPMRALAADTGKALEAPLADLHLPWSVGLRTGDTSAN
ERARQGRRLPTALITTPESLTLILARADAHTAVSTLRMVVVDEWHELLGNKRGVQLQLAL
ARLRHWHPELIVWGVSATLGNQAHAGQVLIPQGNGISVQGADGKALRVDTLLPPTLERFP
WAGHIGLKMLPRVVAEIDASRSCLVFTNTRAQSEIWYQALLETRPDWAGLIALHHSSLSR
DTRDWVEQALKDGQLKAVVCTSSLDLGVDFLPVERVLQIGSAKGVARLMQRAGRSGHAPG
RTSRVTLVPTHSLELIEAAAAQDAVAQRRIEPRESPRKPLDVLVQHLVSMALGGGFVSDE
LFEEVRGAWAYRDLNPAEWAWALAFVRHGGLSLTAYPDYRRVEPDEHGVWRVPDARLARR
HRMSIGTIVSDASLQLKFWSKGGGGKTLGSVEEGFIARLRPGDGFLFAGRLLELVRVEDM
TAYVRRSQAKKAAVPRWNGGRMPLSSELAAAVVARLSEAAAGRFEGPEMHAVQPLLLTQQ
RWSGLPTQSTLLAEALKSREGWHLFLYPFAGRQVHLGLASLLAWRVSQQQPLTFSIAVND
YGLELLSATAVDWSQYLTPGLLSVDHLLTDVLASLNAGELALRRFREIARIAGLVFAGYP
GAPKSTRQVQASSGLFFQVFKQYDADNLLLAQAGEEVLREELDIRRLEQTLQRLNTLKLD
LHVIKRPTPLGFPLLVERFRESMSSEKLADRIRRMVSELEKTADRGDT