Protein Info for Pf6N2E2_294 in Pseudomonas fluorescens FW300-N2E2

Annotation: Arginine-tRNA-protein transferase (EC 2.3.2.8)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 PF04376: ATE_N" amino acids 15 to 85 (71 residues), 88.5 bits, see alignment E=4.2e-29 PF13480: Acetyltransf_6" amino acids 82 to 206 (125 residues), 28.7 bits, see alignment E=2e-10 PF04377: ATE_C" amino acids 105 to 226 (122 residues), 152.5 bits, see alignment E=1.2e-48

Best Hits

Swiss-Prot: 94% identical to BPT_PSEPF: Aspartate/glutamate leucyltransferase (bpt) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00685, arginine-tRNA-protein transferase [EC: 2.3.2.8] (inferred from 99% identity to pba:PSEBR_a3566)

Predicted SEED Role

"Arginine-tRNA-protein transferase (EC 2.3.2.8)" in subsystem Protein degradation (EC 2.3.2.8)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YQX8 at UniProt or InterPro

Protein Sequence (235 amino acids)

>Pf6N2E2_294 Arginine-tRNA-protein transferase (EC 2.3.2.8) (Pseudomonas fluorescens FW300-N2E2)
MTELARLKFYATQPHSCSYLPEEQATTLFLDPSQPMDVHVYADLSEMGFRRSGDHLYRPH
CQHCNACVPARIPVTQFLPNRQQKRIFKRNADLQVRPAKPQFTEEYFDLYQRYIEQRHAD
GDMYPPSRDQFSTFLVRDLPFSRFYEFRLDGRLVAIAVTDLLPNGLSAVYTFYEPDEERR
SLGRFAILWQINEARRLGLEAVYLGYWIKNCKKMNYKTQYRPIELLINQRWVVLS