Protein Info for Pf6N2E2_2930 in Pseudomonas fluorescens FW300-N2E2

Annotation: INTEGRAL MEMBRANE PROTEIN (Rhomboid family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 93 to 119 (27 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details PF07681: DoxX" amino acids 21 to 121 (101 residues), 56.7 bits, see alignment E=3.1e-19 PF04173: DoxD" amino acids 87 to 156 (70 residues), 24.3 bits, see alignment E=2.8e-09

Best Hits

KEGG orthology group: None (inferred from 94% identity to pba:PSEBR_a1180)

Predicted SEED Role

"INTEGRAL MEMBRANE PROTEIN (Rhomboid family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZY74 at UniProt or InterPro

Protein Sequence (159 amino acids)

>Pf6N2E2_2930 INTEGRAL MEMBRANE PROTEIN (Rhomboid family) (Pseudomonas fluorescens FW300-N2E2)
MNALIAGFIQWLEKIPHSLIAFVARFSIAAVFWKSGQTKIEGLAIDLVDGTFQIGLPRLA
DSTIPLFKSEYALPLLSPELAAHLAASAEHVFPILILLGLATRFSALALLGMTLTIQLFV
YPDAYPTHGTWAAVLLYLMARGPGMLSIDHLIAKRYTHG