Protein Info for Pf6N2E2_2926 in Pseudomonas fluorescens FW300-N2E2

Updated annotation (from data): ABC transporter for L-leucine/L-isoleucine/L-phenylalanine/D-alanine, ATPase component 2 LivF
Rationale: Important for utilization of leucine, phenylanine, or D-alanine. Slightly important for utilization of isoleucine as a carbon source and detrimental when isoleucine is the nitrogen source.
Original annotation: Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF00005: ABC_tran" amino acids 17 to 161 (145 residues), 122.7 bits, see alignment E=1.7e-39

Best Hits

Swiss-Prot: 87% identical to BRAG_PSEAE: High-affinity branched-chain amino acid transport ATP-binding protein BraG (braG) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01996, branched-chain amino acid transport system ATP-binding protein (inferred from 100% identity to pba:PSEBR_a1183)

MetaCyc: 69% identical to branched chain amino acid/phenylalanine ABC transporter ATP binding subunit LivF (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWL6 at UniProt or InterPro

Protein Sequence (233 amino acids)

>Pf6N2E2_2926 ABC transporter for L-leucine/L-isoleucine/L-phenylalanine/D-alanine, ATPase component 2 LivF (Pseudomonas fluorescens FW300-N2E2)
MLQFENVSTFYGKIQALHSVNVEVRQGEIVTLIGANGAGKSTLLMTLCGSPQAHSGSIRY
MGEELVGQDSSHIMRKSIAVVPEGRRVFARLTVEENLAMGGFFTDKGDYQEQMDKVLHLF
PRLKERFTQRGGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFDIIEQLR
KDGVTVFLVEQNANQALKIADRAYVLENGRVVMQGTGEALLTDPKVREAYLGG