Protein Info for Pf6N2E2_2916 in Pseudomonas fluorescens FW300-N2E2

Annotation: Major facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 80 to 106 (27 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 254 to 277 (24 residues), see Phobius details amino acids 289 to 308 (20 residues), see Phobius details amino acids 314 to 337 (24 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details amino acids 404 to 426 (23 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 368 (352 residues), 170.6 bits, see alignment E=7.2e-54 PF00083: Sugar_tr" amino acids 45 to 192 (148 residues), 35.6 bits, see alignment E=8.1e-13 PF03137: OATP" amino acids 198 to 302 (105 residues), 29.7 bits, see alignment E=3.3e-11

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a1190)

Predicted SEED Role

"Major facilitator family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0I9 at UniProt or InterPro

Protein Sequence (449 amino acids)

>Pf6N2E2_2916 Major facilitator family transporter (Pseudomonas fluorescens FW300-N2E2)
MQNSTQAANAWRILFLLFLANLFNFFDRTIPAIIIEPIRMEWSLSDFQIGIIGTAFTIVY
AIAGLPLGRMADTGSRSKLMGWGLATWSALTAVNGLVGSFWAFLVVRMGVGIGEASYAPA
ANSLIGDLFPAHRRARAMGIFMLGLPIGLLLAFFTIGAMVKAFDSWRAPFFIAAVPGLVL
ALFMFFIKEPKRGAAETVQVSQEKIDRPIRRVLAIPTFLWLVLAGLCFNFATYACNSFLV
PMLQRYFLMPLHEAAVATGIMVGVTGLFGLTLGGWVADKIHQRVPNGRLLFAAFSLAIST
VTTAWALHAGRIEIGVFVAVFSVGWLFAYNFYTCVYTAIQDVVEPRLRATAMALYFAGLY
LLGGGLGPVVVGGLSDYFARTAMAAAGVEQMTEAFKAIGLHDAMYLIPVALFLTMVFLFL
ASRCFVRDAKRMKEGMSVVMVPGSVAATV