Protein Info for Pf6N2E2_2914 in Pseudomonas fluorescens FW300-N2E2

Updated annotation (from data): 4-hydroxybenzoate 3-monooxygenase (EC 1.14.13.2)
Rationale: Specifically important for utilizing 4-Hydroxybenzoic Acid. Automated validation from mutant phenotype: the predicted function (1.14.13.2) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: P-hydroxybenzoate hydroxylase (EC 1.14.13.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR02360: 4-hydroxybenzoate 3-monooxygenase" amino acids 4 to 392 (389 residues), 674.4 bits, see alignment E=2.2e-207 PF01494: FAD_binding_3" amino acids 5 to 346 (342 residues), 341.5 bits, see alignment E=3.1e-106

Best Hits

Swiss-Prot: 76% identical to PHHY_PSEFL: p-hydroxybenzoate hydroxylase (pobA) from Pseudomonas fluorescens

KEGG orthology group: K00481, p-hydroxybenzoate 3-monooxygenase [EC: 1.14.13.2] (inferred from 98% identity to pba:PSEBR_a1192)

MetaCyc: 76% identical to p-hydroxybenzoate hydroxylase (Pseudomonas fluorescens)
4-hydroxybenzoate 3-monooxygenase. [EC: 1.14.13.2]

Predicted SEED Role

"P-hydroxybenzoate hydroxylase (EC 1.14.13.2)" in subsystem p-Hydroxybenzoate degradation (EC 1.14.13.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWK6 at UniProt or InterPro

Protein Sequence (396 amino acids)

>Pf6N2E2_2914 4-hydroxybenzoate 3-monooxygenase (EC 1.14.13.2) (Pseudomonas fluorescens FW300-N2E2)
MKTLKTQVAIIGAGPSGLLLGQLLHNAGIDTVILERQTPEYVLSRIRAGVLEQGMVELLR
QAGVGQRMDAEGLPHDGFELVLNDRRVHIDLKGLTGGKNVMVYGQTEVTRDLMAAREAAG
ARTLYLASNAQPHDMQTQTPFVTFEHEGETWRLDCDYIAGCDGFHGVARQSIPAEKLKVF
ERVYPFGWLGVLADTPPVHEELVYARHTRGFALCSMRSKTRTRYYLQVPAEEQVADWPDE
RFWGELKNRLPADLAAALVTGPSIEKSIAPLRSFVVEPMQYGRMFLVGDAAHIVPPTGAK
GLNLAASDVSTLFNILLKVYRDGRVELLEKYSAICLRRVWKAERFSWWMTSMLHRFDDDA
FNQRISEAELEYFVDSEAGRKTIAENYVGLPYEAIE