Protein Info for Pf6N2E2_2907 in Pseudomonas fluorescens FW300-N2E2

Annotation: Arginine/ornithine antiporter ArcD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 152 to 176 (25 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details amino acids 234 to 256 (23 residues), see Phobius details amino acids 280 to 311 (32 residues), see Phobius details amino acids 332 to 352 (21 residues), see Phobius details amino acids 358 to 382 (25 residues), see Phobius details amino acids 397 to 413 (17 residues), see Phobius details amino acids 419 to 437 (19 residues), see Phobius details amino acids 449 to 469 (21 residues), see Phobius details TIGR00905: transporter, basic amino acid/polyamine antiporter (APA) family" amino acids 4 to 475 (472 residues), 647.7 bits, see alignment E=1.1e-198 TIGR03810: arginine-ornithine antiporter" amino acids 7 to 474 (468 residues), 733.4 bits, see alignment E=1.1e-224 PF13520: AA_permease_2" amino acids 12 to 415 (404 residues), 260.2 bits, see alignment E=3.8e-81 PF00324: AA_permease" amino acids 16 to 427 (412 residues), 71.6 bits, see alignment E=5.6e-24

Best Hits

Swiss-Prot: 85% identical to ARCD_PSEAE: Arginine/ornithine antiporter (arcD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03758, arginine:ornithine antiporter (inferred from 99% identity to pba:PSEBR_a1199)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZY63 at UniProt or InterPro

Protein Sequence (475 amino acids)

>Pf6N2E2_2907 Arginine/ornithine antiporter ArcD (Pseudomonas fluorescens FW300-N2E2)
MSDTPGKLRLGALVALVVGSMIGGGIFSLPQNMAASADVGAVLIGWAITAVGMLTLAFVF
QTLANRKPDLDGGVYAYAKAGFGDYMGFSSAWGYWISAWLGNVGYFVLLFSTLGYFFPVF
GEGNTVAAVIGSSVLLWAVHFLVLRGIKEAAFINLVTTIAKVVPLVLFVLIAVFAFKLDI
FTADIWGLKNPDLGSVLNQVRNMMLVTVWVFIGIEGASIFSARAEKRTDVGKATVIGFIT
VLLFLVLVNVLSLGIMTQPELAKLQNPSMAAVLEHVVGHWGAVLISVGLIISLLGALLSW
VLLCAEIMFAAAKDHTMPEFLRRENANHVPANALWLTNAMVQLFLVITLFSASTYLSLIY
LATSMILVPYLWSAAYAVLLAVRGETYEGFAAERRKDLIIGAVALIYAVWLLYAGGIKYL
LLSALLYAPGAILFAKAKRELGKPIFTSVEKLIFAAVIAGALVAAYGLYDGFLTL