Protein Info for Pf6N2E2_2900 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG006045: Sigma factor, ECF subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF04542: Sigma70_r2" amino acids 16 to 74 (59 residues), 43 bits, see alignment E=1.1e-14 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 17 to 160 (144 residues), 88.8 bits, see alignment E=1.6e-29 PF07638: Sigma70_ECF" amino acids 66 to 161 (96 residues), 27.6 bits, see alignment E=9.4e-10 PF08281: Sigma70_r4_2" amino acids 112 to 159 (48 residues), 54.2 bits, see alignment E=3.2e-18 PF04545: Sigma70_r4" amino acids 116 to 151 (36 residues), 35.9 bits, see alignment 1.5e-12 PF08279: HTH_11" amino acids 123 to 159 (37 residues), 23.2 bits, see alignment 1.8e-08 PF13384: HTH_23" amino acids 125 to 156 (32 residues), 27.5 bits, see alignment 7.3e-10

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a1206)

Predicted SEED Role

"FIG006045: Sigma factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZBQ1 at UniProt or InterPro

Protein Sequence (173 amino acids)

>Pf6N2E2_2900 FIG006045: Sigma factor, ECF subfamily (Pseudomonas fluorescens FW300-N2E2)
VSQSRFHHVFLAQRTPLLRTLERMVSNPSTAEDLLQETYLRVTRALAERTVEHLEPFVFQ
TARNLALDHLRARRIQSRTLLDDVPPEVVHNVVAPQSSAEDAAHAQQLLERLNVSLQALS
SRQQQIFILSRLHGHSYQQIAERLGVSLSTVQKELKLIMAICVGVAERSHGEQ