Protein Info for Pf6N2E2_29 in Pseudomonas fluorescens FW300-N2E2

Annotation: Sigma-70 factor FpvI (ECF subfamily), controling pyoverdin biosynthesis @ FIG006045: Sigma factor, ECF subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 11 to 161 (151 residues), 80.8 bits, see alignment E=4.3e-27 PF04542: Sigma70_r2" amino acids 13 to 76 (64 residues), 40.2 bits, see alignment E=4.8e-14 PF07638: Sigma70_ECF" amino acids 25 to 150 (126 residues), 37.1 bits, see alignment E=6.2e-13 PF08281: Sigma70_r4_2" amino acids 106 to 157 (52 residues), 51.1 bits, see alignment E=1.7e-17 PF04545: Sigma70_r4" amino acids 110 to 158 (49 residues), 38 bits, see alignment E=1.9e-13

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 88% identity to pfo:Pfl01_3786)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YH39 at UniProt or InterPro

Protein Sequence (166 amino acids)

>Pf6N2E2_29 Sigma-70 factor FpvI (ECF subfamily), controling pyoverdin biosynthesis @ FIG006045: Sigma factor, ECF subfamily (Pseudomonas fluorescens FW300-N2E2)
MTPKLPRSPGFFEHYEELIGTWTRRLRNRQQAEDLAHDTFVRVLESDSSGVEQPRAYLHQ
TARNIAVDGYRREDRRGAMEEAAVDHSQSLSGDPEHYMHAIQLADSIERALAELPANCRT
VFVWQKIEGLTQAEIAERLGLSKNMVEKYMIRTLRHLRDRLDGPGQ