Protein Info for Pf6N2E2_2878 in Pseudomonas fluorescens FW300-N2E2

Updated annotation (from data): required for 4-hydroxybenzoate and octanoate transport, together with MFP and FUSC proteins (Pf6N2E2_2877, Pf6N2E2_2879)
Rationale: PFam PF07869.8 (DUF1656). A conserved cofit operon. Important for utilization of octanoate and 4-hydroxybenzoate, which are probably toxic at the high concentrations used (5-20 mM), but it could also be for uptake rather than efflux.
Original annotation: FIG00953813: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07869: DUF1656
  • amino acids 5 to 59 (55 residues), 64.3 bits, E=4.2e-22

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a1226)

Predicted SEED Role

"FIG00953813: hypothetical protein"

Sequence Analysis Tools

See A0A165ZBK7 at UniProt or InterPro

Protein Sequence (68 amino acids)

>Pf6N2E2_2878 required for 4-hydroxybenzoate and octanoate transport, together with MFP and FUSC proteins (Pf6N2E2_2877, Pf6N2E2_2879) (Pseudomonas fluorescens FW300-N2E2)
MGLREWSIGGVLLSPFLIYVVLALLVTGALRLLLSLMPAGRWIWHEALFDCALYVCVLTV
ITVVLGPL