Protein Info for Pf6N2E2_2876 in Pseudomonas fluorescens FW300-N2E2
Annotation: enoyl-CoA hydratase, R-specific
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a1228)MetaCyc: 87% identical to (R)-specific enoyl-CoA hydratase (Pseudomonas oleovorans)
RXN-7699 [EC: 4.2.1.119]
Predicted SEED Role
"enoyl-CoA hydratase, R-specific" in subsystem n-Phenylalkanoic acid degradation
MetaCyc Pathways
- fatty acid β-oxidation IV (unsaturated, even number) (4/5 steps found)
- polyhydroxydecanoate biosynthesis (2/3 steps found)
- fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
- 6-gingerol analog biosynthesis (engineered) (3/6 steps found)
- fatty acid β-oxidation VII (yeast peroxisome) (2/5 steps found)
- 9-cis, 11-trans-octadecadienoyl-CoA degradation (isomerase-dependent, yeast) (4/10 steps found)
- 10-trans-heptadecenoyl-CoA degradation (MFE-dependent, yeast) (1/6 steps found)
- stearate biosynthesis I (animals) (1/6 steps found)
- 10-cis-heptadecenoyl-CoA degradation (yeast) (2/12 steps found)
- 10-trans-heptadecenoyl-CoA degradation (reductase-dependent, yeast) (2/12 steps found)
- androstenedione degradation I (aerobic) (6/25 steps found)
- superpathway of testosterone and androsterone degradation (6/28 steps found)
- androstenedione degradation II (anaerobic) (4/27 steps found)
- superpathway of cholesterol degradation I (cholesterol oxidase) (9/42 steps found)
- superpathway of cholesterol degradation II (cholesterol dehydrogenase) (9/47 steps found)
- superpathway of cholesterol degradation III (oxidase) (5/49 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.2.1.119
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A159ZZB4 at UniProt or InterPro
Protein Sequence (156 amino acids)
>Pf6N2E2_2876 enoyl-CoA hydratase, R-specific (Pseudomonas fluorescens FW300-N2E2) MTQVTNTPYEALEIGQTASYSKTVEERDIQLFAAMSGDHNPVHLDAEFAAASMFKERIAH GMFSGALISAAVACELPGPGTIYIGQQMSFQKPVKIGDTLTVRLEILEKLPKFRVRIATR VFNQRDELVVDGEAEILAPRKQQTVTLPTLPAITVG