Protein Info for Pf6N2E2_2864 in Pseudomonas fluorescens FW300-N2E2

Annotation: Gluconokinase (EC 2.7.1.12)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01313: carbohydrate kinase, thermoresistant glucokinase family" amino acids 8 to 164 (157 residues), 188.2 bits, see alignment E=4.4e-60 PF13671: AAA_33" amino acids 9 to 140 (132 residues), 29.3 bits, see alignment E=4.8e-11

Best Hits

KEGG orthology group: K00851, gluconokinase [EC: 2.7.1.12] (inferred from 99% identity to pba:PSEBR_a1238)

Predicted SEED Role

"Gluconokinase (EC 2.7.1.12)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZA6 at UniProt or InterPro

Protein Sequence (177 amino acids)

>Pf6N2E2_2864 Gluconokinase (EC 2.7.1.12) (Pseudomonas fluorescens FW300-N2E2)
MNNPITALVIMGVAGCGKTCVSQALCELSGATAIEGDTFHPAANIQKMSAGIPLNDDDRA
GWLDSLCDELRRVDAMGERPVLTCSALKHSYRERLRSALPGLGFVFLELTPEVAADRVSH
RPGHFMPSTLIDSQFATLQSPVGEPLTLALDASSHSVEELAHQAYVWWLDHGLKLAG