Protein Info for Pf6N2E2_2863 in Pseudomonas fluorescens FW300-N2E2

Annotation: Gluconate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 9 to 26 (18 residues), see Phobius details amino acids 32 to 52 (21 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 108 to 136 (29 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 182 to 206 (25 residues), see Phobius details amino acids 230 to 249 (20 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details amino acids 335 to 358 (24 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details amino acids 390 to 413 (24 residues), see Phobius details amino acids 425 to 449 (25 residues), see Phobius details PF02447: GntP_permease" amino acids 10 to 449 (440 residues), 586.3 bits, see alignment E=3.6e-180 TIGR00791: transporter, gluconate:H+ symporter (GntP) family" amino acids 14 to 450 (437 residues), 524.3 bits, see alignment E=1.4e-161 PF03600: CitMHS" amino acids 24 to 394 (371 residues), 47.3 bits, see alignment E=1.6e-16

Best Hits

Swiss-Prot: 82% identical to GNUT_PSEAE: Gluconate permease (gnuT) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03299, gluconate:H+ symporter, GntP family (inferred from 99% identity to pba:PSEBR_a1239)

Predicted SEED Role

"Gluconate permease" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZY33 at UniProt or InterPro

Protein Sequence (450 amino acids)

>Pf6N2E2_2863 Gluconate permease (Pseudomonas fluorescens FW300-N2E2)
MFGMSHETFLLLDAVVTVIGLIILITKFKFHPFIALTIAAAFLGLTSGMPTGTIIKAFQD
GFGGVLGFVGIILALGTMLGKMMAESGGADQIAQTLIRAFGKDKVQWAMMFAAFLVGIPL
FFEIGFVLLIPLVFIVARRTGVSIIKIGIPLLAGLSAVHGLVPPHPGPLLAIGIFGADIG
KTILYGLIVALPTAIIAGPIFGTFIAKHIPGHPNQELVDQLARKTDSADLPSFSITLITV
LSPVFLMLLKTFADVALPDGNLFRAWMDMIGHPISALLLALLLSLYTFGYKQGIGSSQML
KWLDASLAPTAAIILIIGAGGGFKQMLVTSGVGDVIGHMAVSAQISPILLAWLVAAVIRI
ATGSATVATITGAGIVVPVVGMMPGVNRELLVLATGAGSLILSHVNDAGFWLVKQYFNMT
VAETFKTWTAMETILSVVGLIFILLLSLVV