Protein Info for Pf6N2E2_2860 in Pseudomonas fluorescens FW300-N2E2

Annotation: Putative threonine efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 37 to 60 (24 residues), see Phobius details amino acids 67 to 84 (18 residues), see Phobius details amino acids 115 to 138 (24 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details PF01810: LysE" amino acids 12 to 203 (192 residues), 89.6 bits, see alignment E=9.5e-30

Best Hits

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 97% identity to pba:PSEBR_a1241)

Predicted SEED Role

"Putative threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0E6 at UniProt or InterPro

Protein Sequence (220 amino acids)

>Pf6N2E2_2860 Putative threonine efflux protein (Pseudomonas fluorescens FW300-N2E2)
MEFSSGFLLSLSLCLDIGVANIAMITLAMQRGYFQGFALGLGTCVGDLIYAVLALAGMTV
LLQYEAVRWVLWLGGSVLLLYFAAKMIHSAIYHSAVLAEAGEVQGSSSRQEFFRGIFLAM
SSPSAILWFAAVGGTLIARSGGGTLLSSALFLSGFLCAGLLWCAALCLAATQGGKLLGDK
LLRYSYWASAAIFCYFAVYVIVSGYNEFVGKAVANALPGI