Protein Info for Pf6N2E2_2857 in Pseudomonas fluorescens FW300-N2E2

Annotation: Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00583: Acetyltransf_1
  • amino acids 48 to 140 (93 residues), 42.8 bits, E=1.2e-14
• PF08445: FR47
  • amino acids 80 to 141 (62 residues), 22.6 bits, E=1.7e-08
• PF13508: Acetyltransf_7
  • amino acids 81 to 141 (61 residues), 28.1 bits, E=4.5e-10
• PF13673: Acetyltransf_10
  • amino acids 83 to 146 (64 residues), 24.2 bits, E=5.8e-09

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a1244)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

See A0A159ZWH0 at UniProt or InterPro

Protein Sequence (161 amino acids)

>Pf6N2E2_2857 Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1) (Pseudomonas fluorescens FW300-N2E2)
VTAQLVPYEDLTPLQREQVSAIEIHPEQIKFAGDIHGALHTLLSKPGPGVKGFALLAEEV
PVAFLLLKRPPVLPAWANEHSATLHALQVDHRAQGKGYGKACLQALPAVARAAWPEIRGL
ELSVDADNDSAIGLYSRLGWVDSGEAYKGRIGYERRMGLAF