Protein Info for Pf6N2E2_2856 in Pseudomonas fluorescens FW300-N2E2

Annotation: Ketosteroid isomerase homolog

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 PF08332: CaMKII_AD" amino acids 7 to 129 (123 residues), 22.7 bits, see alignment E=2.4e-08 PF13577: SnoaL_4" amino acids 7 to 124 (118 residues), 32.7 bits, see alignment E=1.7e-11 PF13474: SnoaL_3" amino acids 12 to 131 (120 residues), 62.5 bits, see alignment E=1.2e-20 PF14534: DUF4440" amino acids 13 to 122 (110 residues), 30.5 bits, see alignment E=1.1e-10 PF12680: SnoaL_2" amino acids 16 to 120 (105 residues), 47.2 bits, see alignment E=7.4e-16

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a1245)

Predicted SEED Role

"Ketosteroid isomerase homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWM8 at UniProt or InterPro

Protein Sequence (144 amino acids)

>Pf6N2E2_2856 Ketosteroid isomerase homolog (Pseudomonas fluorescens FW300-N2E2)
MNTQVTETEIQVLIDTYRQAVMAKDVEKVMALYDEDIVSFDAIQALQFKGKTAYRAHWQA
CMEMCPGPHKFDFHQVKITPAENIAFAHWLAYCGGTNDKGEEQACWMRVTACYRRVAGQW
RIVHEHWSAPFDPMAGTTLFDLQP