Protein Info for Pf6N2E2_2853 in Pseudomonas fluorescens FW300-N2E2

Annotation: Iron-regulated protein A precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF09375: Peptidase_M75" amino acids 69 to 425 (357 residues), 297.8 bits, see alignment E=4.9e-93

Best Hits

KEGG orthology group: K07231, putative iron-regulated protein (inferred from 99% identity to pba:PSEBR_a1249)

Predicted SEED Role

"Iron-regulated protein A precursor" in subsystem Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZ98 at UniProt or InterPro

Protein Sequence (447 amino acids)

>Pf6N2E2_2853 Iron-regulated protein A precursor (Pseudomonas fluorescens FW300-N2E2)
MIRMPLATASLLAIAISLAGCGEGKDKAAAPQAPTPAASTAAPVAPAAAGKIDEAAAKAV
VAHYADIVYAVYSDAESTAKTLQTAVDAFLAKPNAETLKAAKAAWVAARVPYLQSEVFRF
GNTIIDDWEGQVNAWPLDEGLIDYVDKSYEHALGNPGATANIIANTEVQVGEDKVDVKDI
TPEKLASLNELGGSEANVATGYHAIEFLLWGQDLNGTGPGAGNRPASDYLQGTGATGGHN
DRRRAYLKSVTQLLVNDLEEMVGNWKPNVADNYRATLEAEPAESGLRKMLFGMGSLSLGE
LAGERMKVSLEANSPEDEQDCFSDNTHNSHFYDAKGVRNVYLGEYTRVDGTKMTGASLSS
LVAKADPAADTALKADLADTEAKIQVMVDHANKGEHYDQLIAAGNTAGNQIVRDAIAALV
KQTGSIEQAAGKLGISDLNPDNADHEF