Protein Info for Pf6N2E2_2850 in Pseudomonas fluorescens FW300-N2E2

Annotation: Transporter, LysE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 34 to 56 (23 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 175 to 193 (19 residues), see Phobius details PF01810: LysE" amino acids 10 to 194 (185 residues), 152.5 bits, see alignment E=5e-49

Best Hits

Swiss-Prot: 46% identical to YGGA_AERSA: Putative amino-acid transporter YggA (yggA) from Aeromonas salmonicida

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 98% identity to pba:PSEBR_a1252)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0D8 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Pf6N2E2_2850 Transporter, LysE family (Pseudomonas fluorescens FW300-N2E2)
MNGLLVAFGLIMAIGAQNAFVLAQSLRREHHLPVAALCVTFDALLVAAGVFGLATLLAQS
PLLLSIARWGGAAFLLWYASLALRRACSKQSLRQGENQAVRSLRAVLLSALAVTLLNPHV
YLDTVLLIGSLGAQQSVPGAYVVGAASASLLWFFTLAFGAAWLAPWLARPSTWRILDLLV
AVMMFTVAVQLIVNG