Protein Info for Pf6N2E2_2849 in Pseudomonas fluorescens FW300-N2E2
Annotation: Chromosome initiation inhibitor
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 93% identical to ARGP_PSEPF: HTH-type transcriptional regulator ArgP (argP) from Pseudomonas fluorescens (strain Pf0-1)
KEGG orthology group: K05596, LysR family transcriptional regulator, chromosome initiation inhibitor (inferred from 98% identity to pba:PSEBR_a1253)Predicted SEED Role
"Chromosome initiation inhibitor"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A165ZBF8 at UniProt or InterPro
Protein Sequence (299 amino acids)
>Pf6N2E2_2849 Chromosome initiation inhibitor (Pseudomonas fluorescens FW300-N2E2) MFDYKLLSALAAVVEQAGFERAAQVLGLSQSAISQRIKLLEARVGQPVLVRATPPAPTEI GRRLLNHVQQVRLLERDLQGLVPALDEEGLPERLRIALNADSLATWWAAAVGDFCAEQHL LLDLVVEDQTVGLKRMRAGEVAACVCASERPVAGARSVLLGAMRYRAMASPAFIARHFPD EVRADQLARTPALVFGPDDFLQHRYLASVGVEGGFEHHLCPSSEGFIRLAEVGLGWGLVP ELQVREQLERGVLVELLADKPIDVPLYWHHWRNGGQLLGLLTEQLIRSSRQWLVPWEAQ