Protein Info for Pf6N2E2_2838 in Pseudomonas fluorescens FW300-N2E2

Annotation: 4-hydroxybenzoate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 180 to 204 (25 residues), see Phobius details amino acids 253 to 282 (30 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details amino acids 330 to 346 (17 residues), see Phobius details amino acids 352 to 370 (19 residues), see Phobius details amino acids 390 to 414 (25 residues), see Phobius details amino acids 421 to 442 (22 residues), see Phobius details TIGR00895: MFS transporter, aromatic acid:H+ symporter (AAHS) family" amino acids 13 to 412 (400 residues), 523.3 bits, see alignment E=2e-161 PF07690: MFS_1" amino acids 35 to 288 (254 residues), 122.1 bits, see alignment E=3.9e-39 amino acids 268 to 432 (165 residues), 47.8 bits, see alignment E=1.5e-16 PF00083: Sugar_tr" amino acids 38 to 236 (199 residues), 87.8 bits, see alignment E=1.2e-28 PF06779: MFS_4" amino acids 51 to 208 (158 residues), 36.3 bits, see alignment E=6.3e-13

Best Hits

Swiss-Prot: 89% identical to PCAK_PSEPU: 4-hydroxybenzoate transporter PcaK (pcaK) from Pseudomonas putida

KEGG orthology group: K08195, MFS transporter, AAHS family, 4-hydroxybenzoate transporter (inferred from 99% identity to pba:PSEBR_a1264)

Predicted SEED Role

"4-hydroxybenzoate transporter" in subsystem Cinnamic Acid Degradation or Gentisare degradation or Phenylpropanoid compound degradation or Salicylate and gentisate catabolism or p-Hydroxybenzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0D0 at UniProt or InterPro

Protein Sequence (448 amino acids)

>Pf6N2E2_2838 4-hydroxybenzoate transporter (Pseudomonas fluorescens FW300-N2E2)
MNQPQTSVGHCLDVQSFINAQPISRYQWRVVILCFLIVFLDGLDTAAMGFIAPALSQDWG
IDRASLGPVMSAALIGMVFGALGSGPLADRFGRKVVLVGAVLLFGAFSLASAYSTNVDQL
LVLRFLTGLGLGAGMPNATTLLSEYTPERKKSLLVTSMFCGFNLGMAGGGFISAKLIPAF
GWHSLLLIGGILPLILAVVLLFWLPESARYLVVRNRGTDKVRKTLAPIDPNTVAQAASFS
VPEQKTVKARNVLAVIFSGTYSAGTLLLWLTYFMGLVIVYLLTSWLPTLMRDSGASMEQA
AFIGALFQFGGVLSAVGVGWAMDRFNPHKVIGLFYLMAGVFAYAVGQSLGNITLLATLVL
VAGMCVNGAQSAMPSLAARFYPTQGRATGVSWMLGIGRFGAILGAWMGATLLGLGWNFEQ
VLTALVIPAALATTAVVIKGMVSHADAT