Protein Info for Pf6N2E2_2835 in Pseudomonas fluorescens FW300-N2E2
Annotation: Beta-ketoadipyl CoA thiolase (EC 2.3.1.-)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 90% identical to PCAF_PSEPU: Beta-ketoadipyl-CoA thiolase (pcaF) from Pseudomonas putida
KEGG orthology group: K07823, 3-oxoadipyl-CoA thiolase [EC: 2.3.1.174] (inferred from 98% identity to pba:PSEBR_a1267)MetaCyc: 90% identical to subunit of beta-ketoadipyl CoA thiolase (Pseudomonas putida)
3-oxoadipyl-CoA thiolase. [EC: 2.3.1.174]; Acetyl-CoA C-acyltransferase. [EC: 2.3.1.174, 2.3.1.16]
Predicted SEED Role
"Beta-ketoadipyl CoA thiolase (EC 2.3.1.-)" in subsystem Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 2.3.1.-)
MetaCyc Pathways
- oleate β-oxidation (30/35 steps found)
- fatty acid salvage (6/6 steps found)
- adipate degradation (5/5 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
- 2-methyl-branched fatty acid β-oxidation (11/14 steps found)
- superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
- benzoyl-CoA biosynthesis (3/3 steps found)
- ketolysis (3/3 steps found)
- L-isoleucine degradation I (5/6 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
- 3-oxoadipate degradation (2/2 steps found)
- aromatic compounds degradation via β-ketoadipate (7/9 steps found)
- valproate β-oxidation (7/9 steps found)
- (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (4/5 steps found)
- 4-hydroxybenzoate biosynthesis III (plants) (4/5 steps found)
- adipate biosynthesis (4/5 steps found)
- ketogenesis (4/5 steps found)
- toluene degradation III (aerobic) (via p-cresol) (8/11 steps found)
- fatty acid β-oxidation I (generic) (5/7 steps found)
- polyhydroxybutanoate biosynthesis (2/3 steps found)
- catechol degradation III (ortho-cleavage pathway) (4/6 steps found)
- propanoate fermentation to 2-methylbutanoate (4/6 steps found)
- pyruvate fermentation to butanol II (engineered) (4/6 steps found)
- acetoacetate degradation (to acetyl CoA) (1/2 steps found)
- fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
- glutaryl-CoA degradation (3/5 steps found)
- pyruvate fermentation to hexanol (engineered) (7/11 steps found)
- fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
- superpathway of salicylate degradation (4/7 steps found)
- 5,6-dehydrokavain biosynthesis (engineered) (6/10 steps found)
- L-glutamate degradation V (via hydroxyglutarate) (6/10 steps found)
- superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
- fatty acid β-oxidation VII (yeast peroxisome) (2/5 steps found)
- 2-deoxy-D-ribose degradation II (4/8 steps found)
- (2S)-ethylmalonyl-CoA biosynthesis (1/4 steps found)
- (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
- superpathway of phenylethylamine degradation (6/11 steps found)
- 4-methylcatechol degradation (ortho cleavage) (3/7 steps found)
- acetyl-CoA fermentation to butanoate (3/7 steps found)
- benzoyl-CoA degradation I (aerobic) (3/7 steps found)
- pyruvate fermentation to butanoate (3/7 steps found)
- 3-phenylpropanoate degradation (5/10 steps found)
- superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (5/10 steps found)
- 4-ethylphenol degradation (anaerobic) (2/6 steps found)
- 4-oxopentanoate degradation (4/9 steps found)
- phenylacetate degradation I (aerobic) (4/9 steps found)
- glycerol degradation to butanol (9/16 steps found)
- ethylbenzene degradation (anaerobic) (1/5 steps found)
- isopropanol biosynthesis (engineered) (1/5 steps found)
- pyruvate fermentation to acetone (1/5 steps found)
- pyruvate fermentation to butanol I (3/8 steps found)
- mevalonate pathway I (eukaryotes and bacteria) (2/7 steps found)
- mevalonate pathway II (haloarchaea) (2/7 steps found)
- 9-cis, 11-trans-octadecadienoyl-CoA degradation (isomerase-dependent, yeast) (4/10 steps found)
- L-lysine fermentation to acetate and butanoate (4/10 steps found)
- 10-trans-heptadecenoyl-CoA degradation (MFE-dependent, yeast) (1/6 steps found)
- benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
- 2-methylpropene degradation (2/8 steps found)
- isoprene biosynthesis II (engineered) (2/8 steps found)
- mevalonate pathway III (Thermoplasma) (2/8 steps found)
- mevalonate pathway IV (archaea) (2/8 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (9/18 steps found)
- mandelate degradation to acetyl-CoA (9/18 steps found)
- methyl tert-butyl ether degradation (3/10 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (5/13 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)
- L-glutamate degradation VII (to butanoate) (3/12 steps found)
- 10-cis-heptadecenoyl-CoA degradation (yeast) (2/12 steps found)
- 10-trans-heptadecenoyl-CoA degradation (reductase-dependent, yeast) (2/12 steps found)
- ethylmalonyl-CoA pathway (1/11 steps found)
- (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
- crotonate fermentation (to acetate and cyclohexane carboxylate) (4/16 steps found)
- superpathway of aerobic toluene degradation (14/30 steps found)
- L-tryptophan degradation III (eukaryotic) (3/15 steps found)
- docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
- benzoate fermentation (to acetate and cyclohexane carboxylate) (4/17 steps found)
- toluene degradation VI (anaerobic) (4/18 steps found)
- cholesterol degradation to androstenedione I (cholesterol oxidase) (3/17 steps found)
- jasmonic acid biosynthesis (4/19 steps found)
- superpathway of aromatic compound degradation via 3-oxoadipate (15/35 steps found)
- superpathway of L-lysine degradation (19/43 steps found)
- sitosterol degradation to androstenedione (1/18 steps found)
- androstenedione degradation I (aerobic) (6/25 steps found)
- platensimycin biosynthesis (6/26 steps found)
- cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (3/22 steps found)
- superpathway of testosterone and androsterone degradation (6/28 steps found)
- superpathway of ergosterol biosynthesis I (4/26 steps found)
- androstenedione degradation II (anaerobic) (4/27 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)
- superpathway of cholesterol degradation I (cholesterol oxidase) (9/42 steps found)
- superpathway of cholesterol biosynthesis (4/38 steps found)
- superpathway of cholesterol degradation II (cholesterol dehydrogenase) (9/47 steps found)
- superpathway of cholesterol degradation III (oxidase) (5/49 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- Alkaloid biosynthesis I
- Alkaloid biosynthesis II
- Anthocyanin biosynthesis
- Benzoate degradation via CoA ligation
- Benzoate degradation via hydroxylation
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Biosynthesis of type II polyketide backbone
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Carotenoid biosynthesis - General
- Diterpenoid biosynthesis
- Ether lipid metabolism
- Ethylbenzene degradation
- Fatty acid biosynthesis
- Fatty acid elongation in mitochondria
- Fatty acid metabolism
- Geraniol degradation
- Glycerophospholipid metabolism
- Glycosphingolipid biosynthesis - ganglio series
- Histidine metabolism
- Limonene and pinene degradation
- Lipopolysaccharide biosynthesis
- Lysine degradation
- Phenylalanine metabolism
- Tyrosine metabolism
- Valine, leucine and isoleucine degradation
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.16
Use Curated BLAST to search for 2.3.1.- or 2.3.1.16 or 2.3.1.174
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A159ZWL2 at UniProt or InterPro
Protein Sequence (400 amino acids)
>Pf6N2E2_2835 Beta-ketoadipyl CoA thiolase (EC 2.3.1.-) (Pseudomonas fluorescens FW300-N2E2) MRDVYICDAIRTPIGRFGGGLSAVRADDLAAVPIKALMERNPSVDWSAVDEVFLGCANQA GEDNRNVARMALLLAGLPDSIPGVTLNRLCASGMDAIGTAFRAIASGEMELAIAGGVESM SRAPFVMGKADAAFSRSMKLEDTTIGWRFINPLMKAQYGVDAMPQTADNVADDYAVSRAD QDAFALRSQQRTAAAQAAGFFAEEIVAVRIAHKKGETVVEQDEHPRADTTLETLGKLKPV NGPDKTVTAGNASGVNDGAAALILASAEAVKKHGLTPRGKVLGMASAGVAPRVMGIGPVP AVRKLTERLGLAVADFDVIELNEAFASQGLAVLRDLGLADDAPQVNPNGGAIALGHPLGM SGARLVLTALHHLEKTGGKKGLATMCVGVGQGLALAIERV