Protein Info for Pf6N2E2_2830 in Pseudomonas fluorescens FW300-N2E2

Annotation: Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02427: 3-oxoadipate enol-lactonase
  • amino acids 11 to 260 (250 residues), 347.1 bits, E=2.7e-108
• PF00561: Abhydrolase_1
  • amino acids 22 to 244 (223 residues), 73.2 bits, E=4.1e-24
• PF12697: Abhydrolase_6
  • amino acids 25 to 252 (228 residues), 55.5 bits, E=2e-18
• PF12146: Hydrolase_4
  • amino acids 46 to 231 (186 residues), 53.7 bits, E=2.8e-18

Best Hits

Swiss-Prot: 46% identical to ELH1_ACIAD: 3-oxoadipate enol-lactonase 1 (pcaD) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K01055, 3-oxoadipate enol-lactonase [EC: 3.1.1.24] (inferred from 98% identity to pba:PSEBR_a1272)

MetaCyc: 71% identical to subunit of 3-oxoadipate enol-lactone hydrolase (Pseudomonas putida)
3-oxoadipate enol-lactonase. [EC: 3.1.1.24]

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

• protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
• aromatic compounds degradation via β-ketoadipate (7/9 steps found)
• toluene degradation III (aerobic) (via p-cresol) (8/11 steps found)
• catechol degradation III (ortho-cleavage pathway) (4/6 steps found)
• catechol degradation to β-ketoadipate (2/4 steps found)
• superpathway of salicylate degradation (4/7 steps found)
• 4-methylcatechol degradation (ortho cleavage) (3/7 steps found)
• mandelate degradation to acetyl-CoA (9/18 steps found)
• superpathway of aerobic toluene degradation (14/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (15/35 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.24

Use Curated BLAST to search for 3.1.1.24

Sequence Analysis Tools

See A0A159ZY09 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Pf6N2E2_2830 Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24) (Pseudomonas fluorescens FW300-N2E2)
VGFVKLAEGDLNYRFDGPQDAPVLVLSNSLGTDLHMWDEQVAAFSEHFRVLRFDTRGHGQ
SLVTEGPYSIEQLGRDVLAMLDQLNIDKVHFCGLSMGGLIGQWLGINAGERLYKLVVCNT
AAKIGDPSVWNPRIETVLRDGKAAMVALRDASIARWFTPDFAEAQPATAKKITDMLAATS
PQGYAANCAAVRDADFREQLSSIRVPLLVIAGTEDAVTPPSGGHFIQERVRGAEYAEFYA
AHLSNVQAGAAFSARVLDFLLDSGRA