Protein Info for Pf6N2E2_2824 in Pseudomonas fluorescens FW300-N2E2

Annotation: RND efflux system, inner membrane transporter CmeB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1054 transmembrane" amino acids 10 to 28 (19 residues), see Phobius details amino acids 340 to 359 (20 residues), see Phobius details amino acids 366 to 388 (23 residues), see Phobius details amino acids 395 to 414 (20 residues), see Phobius details amino acids 438 to 459 (22 residues), see Phobius details amino acids 470 to 493 (24 residues), see Phobius details amino acids 539 to 557 (19 residues), see Phobius details amino acids 877 to 895 (19 residues), see Phobius details amino acids 902 to 922 (21 residues), see Phobius details amino acids 929 to 952 (24 residues), see Phobius details amino acids 974 to 995 (22 residues), see Phobius details amino acids 1005 to 1029 (25 residues), see Phobius details TIGR00915: RND transporter, hydrophobe/amphiphile efflux-1 (HAE1) family" amino acids 1 to 1050 (1050 residues), 1837.6 bits, see alignment E=0 PF00873: ACR_tran" amino acids 1 to 1031 (1031 residues), 1358.6 bits, see alignment E=0 PF03176: MMPL" amino acids 341 to 499 (159 residues), 31.3 bits, see alignment E=1.6e-11 amino acids 841 to 1035 (195 residues), 20.6 bits, see alignment E=2.9e-08

Best Hits

Swiss-Prot: 84% identical to MEPB_PSEPU: Multidrug/solvent efflux pump membrane transporter MepB (mepB) from Pseudomonas putida

KEGG orthology group: K03296, hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 family (inferred from 65% identity to abo:ABO_0964)

MetaCyc: 65% identical to multidrug efflux pump RND permease AcrF (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-367

Predicted SEED Role

"RND efflux system, inner membrane transporter CmeB" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZY66 at UniProt or InterPro

Protein Sequence (1054 amino acids)

>Pf6N2E2_2824 RND efflux system, inner membrane transporter CmeB (Pseudomonas fluorescens FW300-N2E2)
MSKFFIDRPIFAWVIALVIMLVGALSILKLPINQYPSIAPPAIAIQVTYPGASAQTVQDT
VVQVIEQQLNGIDNLRYVSSESNSDGSMTITATFEQGTNSDTAQVQVQNKLNLATPLLPQ
EVQQQGIRVTKSVRNFLMVIGVVSRDGSMTREDLSNYIVSNMQDPISRTAGVGDFQVFGA
QYAMRIWLDPAKLNNFNLTPVDVSTAITAQNVQIASGQLGGLPAMPGQQLNATIIGKTRL
QTAEQFKAILLKVNPDGSQVRVGDVADVALGGENYSINAQFNGAPASGLAVRLATGANAL
DTAKALRKTVDDLKPFFPQGLEVVFPYDTTPVVSESIKGVVETLVEAIVLVFLVMFLFLQ
NFRATIITTMTVPVVLLGTFGILAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVM
SEEGLSPKEATKKSMGQIQGALVGIALVLSAVLLPMAFFGGSTGVIYKQFSITIVSAMAL
SVLVALIFTPALCATMLKPIPKGEHGTPKRGFFGWFNRTFDRGVRSYERGVGNMLKHKAP
YLLAYIIIVVGMVWLFTRIPTAFLPEEDQGVLFAQVQTPAGSSAERTQVVVDKMREFLLR
PSKDGGEGDGVASVFTVTGFNFAGRGQSSGLAFIMLKPWEERNADNTVFKIAGRAQQHFF
TFRDAMVFAFAPPAVMELGNATGFDVFLQDRAGIGHEKLMEARNQFLGMASQSKILAQVR
PNGLNDEPQYQLEIDDEKASALGITLSEINNTLSIALGSNYVNDFIDRGRVKRVYVQGQP
NSRMSPEDLKKWYVRNSAGTMVPFSAFAKGEWVYGSPKLARYNGVEAMEILGTPAPGYST
GEAMAEVETIAKKLPAGVGISWTGLSYEERLSGSQAPALYALSLLMVFLCLAALYESWSI
PIAVMLVVPLGIIGALMATSLRGLSNDVYFQVGLLTTIGLAAKNAILIVEFAKELHEQGR
TLMEAAIEACRMRLRPIIMTSLAFILGVVPLAISTGAGSGSQHAIGTGVIGGMLTATILA
IFWVPLFFVTVSSIGRRKNTDEHDTPETSKEAGQ