Protein Info for Pf6N2E2_2822 in Pseudomonas fluorescens FW300-N2E2

Annotation: Transcription repressor of multidrug efflux pump acrAB operon, TetR (AcrR) family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 PF00440: TetR_N" amino acids 16 to 62 (47 residues), 64.4 bits, see alignment 9.5e-22 PF08361: TetR_C_2" amino acids 84 to 203 (120 residues), 124.9 bits, see alignment E=3e-40 PF13977: TetR_C_6" amino acids 126 to 202 (77 residues), 31 bits, see alignment E=3.8e-11

Best Hits

Swiss-Prot: 70% identical to TTGR_PSEPK: Probable HTH-type transcriptional regulator TtgR (ttgR) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03577, TetR/AcrR family transcriptional regulator, acrAB operon repressor (inferred from 94% identity to pba:PSEBR_a1279)

Predicted SEED Role

"Transcription repressor of multidrug efflux pump acrAB operon, TetR (AcrR) family" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0C7 at UniProt or InterPro

Protein Sequence (210 amino acids)

>Pf6N2E2_2822 Transcription repressor of multidrug efflux pump acrAB operon, TetR (AcrR) family (Pseudomonas fluorescens FW300-N2E2)
MVRRTKEEALETRSQILEAAEKAFFERGVARTTLADIATLAGVTRGAIYWHFSNKADLLQ
AMLDTLHEPLDDLARASENEEELDPLGCTRKLLVQLFQQVALDPKTRRINEILFHKCEFT
DEMCDLRQQRRQVSLDCNVRIVLSLSNAMKRGQLPDDLDPERAAIAIHGYIDGILYQWLL
APDSFALAAEAERWVDIGLDMLRLSPSLRK