Protein Info for Pf6N2E2_2819 in Pseudomonas fluorescens FW300-N2E2

Annotation: Putative sugar transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 40 to 62 (23 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 95 to 121 (27 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 199 to 223 (25 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 267 to 289 (23 residues), see Phobius details amino acids 295 to 315 (21 residues), see Phobius details amino acids 324 to 344 (21 residues), see Phobius details amino acids 354 to 375 (22 residues), see Phobius details PF07690: MFS_1" amino acids 8 to 314 (307 residues), 141.5 bits, see alignment E=4.8e-45 PF06779: MFS_4" amino acids 12 to 371 (360 residues), 30.5 bits, see alignment E=3.9e-11 PF00083: Sugar_tr" amino acids 41 to 178 (138 residues), 34.1 bits, see alignment E=2.2e-12

Best Hits

Swiss-Prot: 36% identical to YFHI_BACSU: Uncharacterized MFS-type transporter YfhI (yfhI) from Bacillus subtilis (strain 168)

KEGG orthology group: K08156, MFS transporter, DHA1 family, arabinose polymer transporter (inferred from 99% identity to pba:PSEBR_a1282)

Predicted SEED Role

"Putative sugar transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZYF6 at UniProt or InterPro

Protein Sequence (388 amino acids)

>Pf6N2E2_2819 Putative sugar transport protein (Pseudomonas fluorescens FW300-N2E2)
MPLSLLILALSAFAIGTTEFVIMGLLPDVAADLGVSIPGAGWLVTGYALGVAIGAPFMAL
ATARLPRKAALVVLMGIFIIGNLLCAIASDYNVLMFARVVTALCHGAFFGIGSVVAAGLV
APNKRASAVALMFTGLTLANVLGVPLGTALGQEAGWRSTFWAVTVIGVIALIGLIRFLPA
KRDEEKLDMRSELVALKGAGLWLSLSMTALFSASVFTLFTYVAPLLGEVTGVSPRGVTWT
LVLIGLGLTLGNIIGGKLADKSLANTLMGVFLTMAVVSTVLSWTSVALIPSEITLFLWAT
ACFAAVPALQVNVVTFGKAAPNLVSTLNIGAFNIGNALGAWVGGSVIDHGLGLTSVPLAA
GALAVLALLVTLITFRQGGNAELAPATH