Protein Info for Pf6N2E2_2801 in Pseudomonas fluorescens FW300-N2E2

Annotation: Bicyclomycin resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 42 to 60 (19 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 206 to 230 (25 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 299 to 320 (22 residues), see Phobius details amino acids 331 to 356 (26 residues), see Phobius details amino acids 362 to 382 (21 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 348 (338 residues), 141.8 bits, see alignment E=1.3e-45

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a1301)

Predicted SEED Role

"Bicyclomycin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZ58 at UniProt or InterPro

Protein Sequence (387 amino acids)

>Pf6N2E2_2801 Bicyclomycin resistance protein (Pseudomonas fluorescens FW300-N2E2)
MKNRTTLIVTCTTVFLAQLGMSIYLPALPDIARDLGADASRVSWGLSVYLIGMALPMLLW
GSLSQRLGRKPVLLAALGLYGLGNLALPLGTTVEAFLTLRLIQGIGASGISVMARVLIRD
SFSGDLLAKALSWISIAFVIALGIGQYLGSLIQAVFGWEAIFQGLGAVSLAMAAAVSRAR
FPVLVQTGNGQSAWGIYGHILRQRAFLLPALAGGLGYGVIVAFNTAAPLILQESFHWSPI
EYGLLGWPVSAAYLLGALVVNAFVLRTGQRRMMGWGIALVLGGSMSMLAGSLTLSSVALL
FWLPYCFAVFGQSLIYPISLSLANEGSPVAGAYAMALSGFLHQLMASVIGAMASLLLSQQ
AWPLAALCALLGAAAMLCVKFVPPRVA