Protein Info for Pf6N2E2_2794 in Pseudomonas fluorescens FW300-N2E2

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details PF04120: Iron_permease" amino acids 3 to 119 (117 residues), 160.8 bits, see alignment E=7.1e-52

Best Hits

KEGG orthology group: None (inferred from 92% identity to pba:PSEBR_a1306)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WV02 at UniProt or InterPro

Protein Sequence (134 amino acids)

>Pf6N2E2_2794 putative membrane protein (Pseudomonas fluorescens FW300-N2E2)
MAFAKIAQKLALWAGSPKTFLGAIVLLALWAASGPFFGFNDTWQLIINTSTTIITFLMVF
LIQNTQNRDTDILHLKVDELLRATKDAQNAMLGLESLDLKQLEALRKHYQDMGKDEAKSL
DGLEQKNKIDLNQC