Protein Info for Pf6N2E2_2786 in Pseudomonas fluorescens FW300-N2E2

Annotation: (R)-3-hydroxydecanoyl-ACP:CoA transacylase PhaG (3-hydroxyacyl-CoA-acyl carrier protein transferase) (EC 2.4.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF12146: Hydrolase_4" amino acids 26 to 241 (216 residues), 31.7 bits, see alignment E=1.5e-11 PF00561: Abhydrolase_1" amino acids 29 to 256 (228 residues), 42.6 bits, see alignment E=9.1e-15 PF12697: Abhydrolase_6" amino acids 30 to 257 (228 residues), 29.8 bits, see alignment E=1.4e-10

Best Hits

Swiss-Prot: 68% identical to PHAG_PSEPK: (R)-3-hydroxydecanoyl-ACP:CoA transacylase (phaG) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a1313)

MetaCyc: 68% identical to 3-hydroxyacyl-CoA-acyl carrier protein transferase (Pseudomonas putida KT2440)
2.4.1.-

Predicted SEED Role

"(R)-3-hydroxydecanoyl-ACP:CoA transacylase PhaG (3-hydroxyacyl-CoA-acyl carrier protein transferase) (EC 2.4.1.-)" in subsystem Rhamnolipids in Pseudomonas (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZB03 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Pf6N2E2_2786 (R)-3-hydroxydecanoyl-ACP:CoA transacylase PhaG (3-hydroxyacyl-CoA-acyl carrier protein transferase) (EC 2.4.1.-) (Pseudomonas fluorescens FW300-N2E2)
MRPEIAVLDIQGQYRVYTEFYRADAAQKTIILVNGSMATTASFAQTAKNLYPQFNVVLYD
QPYAGKSKAHNRHETMLTKEVEGQILLELIDHFAAEHVLSFSWGGAATLTALAQRPRRIE
KAVISSFSPVLNAPMRDYLERGVDYLSSLDGDRVGHLVNSTIGKHLPPLFKRFNYRHVSS
LAEHEYGQMHFHISDVLHSDQLCYVNAAKKINVPVLFLNGEWDEYTAADDARLFADHVQY
SSFSTLQATGHFLDMEHKAACRDSRNALLDFLKPAHHESRPRYNYVQDYHALAI