Protein Info for Pf6N2E2_2770 in Pseudomonas fluorescens FW300-N2E2

Annotation: Tricarboxylate transport membrane protein TctA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 transmembrane" amino acids 15 to 39 (25 residues), see Phobius details amino acids 45 to 72 (28 residues), see Phobius details amino acids 109 to 134 (26 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 171 to 193 (23 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 250 to 281 (32 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details amino acids 330 to 350 (21 residues), see Phobius details amino acids 356 to 376 (21 residues), see Phobius details amino acids 385 to 407 (23 residues), see Phobius details amino acids 409 to 428 (20 residues), see Phobius details amino acids 434 to 452 (19 residues), see Phobius details amino acids 467 to 490 (24 residues), see Phobius details PF01970: TctA" amino acids 20 to 440 (421 residues), 490.3 bits, see alignment E=2.1e-151

Best Hits

KEGG orthology group: K07793, putative tricarboxylic transport membrane protein (inferred from 99% identity to pba:PSEBR_a1329)

Predicted SEED Role

"Tricarboxylate transport membrane protein TctA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZAY8 at UniProt or InterPro

Protein Sequence (504 amino acids)

>Pf6N2E2_2770 Tricarboxylate transport membrane protein TctA (Pseudomonas fluorescens FW300-N2E2)
MDTLNYLGQGFGVALTPYNLVTALTGTLIGTVVGLLPGLGPINGVALLIPIAFALGLPPE
SALILLAAVYLGCEYGGRISSILLNIPGEASTVMTTLDGYPMARQGLAGVALSLSAWSSF
IGAFIATCGMVLFAPLLAKWAIAFGPAEYFVLMVFAIVCLGGMAGDRPLKTFIAALIGLF
LSSVGIDANSGVYRFTGDNIHLTDGIQFVVLVLGLFSISEILLLLEKTHRGQEAVKATGR
MMFNFKEAASVFTVNLRCGVLGFIMGVLPGAGATLASAVAYMTEKRIAGAGGSFGQGDKR
GLAAPETAIGGAACGALVPMLTLGVPGSGTTAVMIGALSLYNITPGPLLFQQQPDIVWGL
IASLFVANIMLVILNIPMIRIFTRILAVPNWALVPVIAIITGIGVYAVHATTFDLFLMIG
IGIFGYILRKLDFPLSPVLLGFILGGLMEQNLRRALSISNGALEILWSSPITFGCWILTA
IMLFMPLLRIWRRRAAQRRALANV