Protein Info for Pf6N2E2_2755 in Pseudomonas fluorescens FW300-N2E2

Annotation: Sigma factor RpoE negative regulatory protein RseA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 85 to 105 (21 residues), see Phobius details PF03872: RseA_N" amino acids 7 to 74 (68 residues), 49.5 bits, see alignment E=5.2e-17 PF03873: RseA_C" amino acids 125 to 177 (53 residues), 45.1 bits, see alignment E=1e-15

Best Hits

Swiss-Prot: 70% identical to MUCA_PSEAE: Sigma factor AlgU negative regulatory protein (mucA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03597, sigma-E factor negative regulatory protein RseA (inferred from 100% identity to pba:PSEBR_a1339)

Predicted SEED Role

"Sigma factor RpoE negative regulatory protein RseA" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A081 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Pf6N2E2_2755 Sigma factor RpoE negative regulatory protein RseA (Pseudomonas fluorescens FW300-N2E2)
MSREALQESLSAVMDNEADELELRRVLNAFDDVETRETWARYQIARAVMHKDLLLPRLDI
AAAVSAALADEAVPAKASRGPWRSLGRLAVAASVTVAVLAGVRLYNQDEIAGVQMAQQSN
QPGLAAPQVKGPAVLAGYSEGSETAGPMVNGVLQGQPGWHDQRLPNYLRQHAQQAALKGT
ESALPYARAASMENR