Protein Info for Pf6N2E2_2753 in Pseudomonas fluorescens FW300-N2E2

Annotation: HtrA protease/chaperone protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR02037: peptidase Do" amino acids 31 to 472 (442 residues), 531.4 bits, see alignment E=8.8e-164 PF00089: Trypsin" amino acids 97 to 254 (158 residues), 63.9 bits, see alignment E=4.9e-21 PF13365: Trypsin_2" amino acids 100 to 233 (134 residues), 133.2 bits, see alignment E=3.2e-42 PF00595: PDZ" amino acids 267 to 329 (63 residues), 43 bits, see alignment E=1.2e-14 amino acids 383 to 460 (78 residues), 34.2 bits, see alignment E=6.8e-12 PF13180: PDZ_2" amino acids 274 to 363 (90 residues), 59 bits, see alignment E=1.2e-19 amino acids 388 to 468 (81 residues), 35.1 bits, see alignment E=3.5e-12 PF17820: PDZ_6" amino acids 299 to 351 (53 residues), 45.8 bits, see alignment 1.1e-15 amino acids 411 to 463 (53 residues), 37.4 bits, see alignment 4.5e-13

Best Hits

Swiss-Prot: 93% identical to DEGPL_PSEF5: Probable periplasmic serine endoprotease DegP-like (mucD) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: None (inferred from 100% identity to pba:PSEBR_a1341)

Predicted SEED Role

"HtrA protease/chaperone protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZXV2 at UniProt or InterPro

Protein Sequence (476 amino acids)

>Pf6N2E2_2753 HtrA protease/chaperone protein (Pseudomonas fluorescens FW300-N2E2)
MSIPRLKTYLSILATVLVLGQAVPAVAVELPDFTQLVEQASPAVVNISTTQKLPDRRVSD
QQMPDLEGLPPMLREFFERGMPQQPRSPGGGRQREAQSLGSGFIISSDGYILTNNHVIAD
ADEILVRLADRSELKAKLIGTDPRSDVALLKIEGKDLPVLKLGKSQDLKAGQWVVAIGSP
FGFDHTVTQGIVSAIGRSLPNENYVPFIQTDVPINPGNSGGPLFNLAGEVVGINSQIYTR
SGGFMGVSFAIPIDVAMDVSNQLKSEGKVSRGWLGVVIQEVNKDLAESFGLEKPAGALVA
QIQEGGPAAKGGLQVGDVILSMNGQPIVMSADLPHLVGALKAGAKANLEVIREGKRKNVE
LTVGAIPEEGKELDSLPKSGVERSSNRLGVAVAELTEEQKRTLELQGGVVIKEVQDGPAA
LIGLQPGDIITHLNNQAIGSAKEFTDIAKALPKNRSVSMRVLRQGRASFITFKLAE