Protein Info for Pf6N2E2_2729 in Pseudomonas fluorescens FW300-N2E2

Annotation: membrane protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 549 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 42 to 66 (25 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details PF08019: EptA_B_N" amino acids 53 to 203 (151 residues), 175.3 bits, see alignment E=8.1e-56 PF00884: Sulfatase" amino acids 233 to 521 (289 residues), 233.8 bits, see alignment E=2.9e-73

Best Hits

KEGG orthology group: K03760, phosphoethanolamine transferase (inferred from 96% identity to pba:PSEBR_a1364)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZW75 at UniProt or InterPro

Protein Sequence (549 amino acids)

>Pf6N2E2_2729 membrane protein, putative (Pseudomonas fluorescens FW300-N2E2)
MLTIKAVRPEWVTLAASAFLLVGFNLVLWQHLLAITTADARGLLMCVAFGLMIFCAFNLV
LTLVAFRPLLKPVLMLLFLISAGVAYFMAQYGVLIDAGMLRNFAETNATEVRDLLSLKLF
IYLGLLGVLPCWLLFKTPISYRRWPKELLSKLLVGVASAAVIGMVALANYQGLSSLFRNH
HELRLMVVPSNYIGASLGYLREQVASAKQPFITLGEDASRNPAWQTHGRKSLTVLVVGES
ARAENFGILGYDRDTTPTLDKEAGLIAFTDVHSCGTETAVSVPCMFSNMGRKNYDASKAK
NEEGLLDVLKHAGLEVIWRDNQSGCKGTCNRVTLQDVSNLKDPALCANSECRDEILLQGL
QHFIDTLDKDTVLVLHQMGSHGPEYFKRYPKEYEHFTPVCESNALNNCSRESIVNGYDNT
LVYTDHVLSTLIDLLRANQDKVDTAMLYLSDHGESLGEYNLFLHGTPYMLAPEQQKHVAM
LAWFSDSYQKSFSVDTHCLQLSRQKPLSQDNLFHSMLGLLEVNSQVYNRDLDLFASCRGA
VIDGVLARE