Protein Info for Pf6N2E2_2708 in Pseudomonas fluorescens FW300-N2E2

Annotation: Lactam utilization protein LamB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF03746: LamB_YcsF" amino acids 6 to 244 (239 residues), 318.4 bits, see alignment E=1.7e-99

Best Hits

Swiss-Prot: 90% identical to PXPA_PSEPF: 5-oxoprolinase subunit A (pxpA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K07160, UPF0271 protein (inferred from 96% identity to pba:PSEBR_a1384)

Predicted SEED Role

"Lactam utilization protein LamB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWB6 at UniProt or InterPro

Protein Sequence (250 amino acids)

>Pf6N2E2_2708 Lactam utilization protein LamB (Pseudomonas fluorescens FW300-N2E2)
VNRLLLNCDIGESFGNWTMGLDAEVMPFIDCANIACGFHAGDPSIMRKTVSLALSHGVRI
GAHPAYQDLAGFGRRSMAYGAQELQDLLHYQIGALDGICRAQGGRVSYVKPHGAMYNDMM
ANPAQLRAVIQAVAAYDRQLPLMLMATRDNSAAQALGDEYGLTLWFEAFADRAYDSAGRL
VSRQAPGAVHHDPEVIVGQALAIARGNALTASDGSALHLIANTLCVHGDNASSVAAVQRI
REALDRQSAP