Protein Info for Pf6N2E2_2692 in Pseudomonas fluorescens FW300-N2E2

Annotation: RNA polymerase sigma factor RpoE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 20 to 189 (170 residues), 72.6 bits, see alignment E=1.5e-24 PF04542: Sigma70_r2" amino acids 24 to 90 (67 residues), 47.4 bits, see alignment E=2.7e-16 PF08281: Sigma70_r4_2" amino acids 138 to 189 (52 residues), 41.1 bits, see alignment E=2.3e-14 PF04545: Sigma70_r4" amino acids 144 to 190 (47 residues), 28.1 bits, see alignment 2.3e-10

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 98% identity to pba:PSEBR_a1397)

Predicted SEED Role

"RNA polymerase sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZXQ5 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Pf6N2E2_2692 RNA polymerase sigma factor RpoE (Pseudomonas fluorescens FW300-N2E2)
MTVTDDTLLLQRLLAGEQQAYKELVSAYQSPMRAVAYAIVGSRHVDEVVQDAWLSVVRNL
SGFQGRSSLKTWLLTITANAARGRYKQNRREVLFDDLPSPHGTLGDDRFAADGHWLLAPF
AWHQDTPEALLTMAELRDCLEHTLLSLSELQGSVLNLRERQGLELEEICNLLDISLSNVR
VLLHRARLKVFATVEHFEETGEC